Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR14 IGR15 IGR16 IGR17 IGR19 IGR18 CPn0026 CPn0025 xerC, - CPn0024 yjjK, - CPn0023 CPn0021 CPn0020 lon, - CPn0027 CPn0026 CPn0025 xerC, - CPn0024 yjjK, - CPn0023 CPn0021 CPn0020 lon, - CPn0027 CPn0026 CPn0025 xerC, - CPn0024 yjjK, - CPn0023 CPn0021 CPn0020 lon, - CPn0027 maf, - CPn0022 maf, - CPn0022
* Calculated from Protein Sequence

Gene ID: CPn0023

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yjjK  

Definition:
ABC transporter protein (ATPASE)

Gene Start:
36603

Gene Stop:
35011

Gene Length:
1593

Molecular Weight*:
59100

pI*:
5.40

Net Charge*:
-12.87

EC:
 

Functional Class:
transport and binding proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to ABC transporter sequences; e.g. residues 1-528 are 84% similar to CT348; residues 17-505 are 37% similar to TP0838; residues 315-512 are 25% similar to MG119; residues 13-473 are 21% similar to UU015; residues 3-522 are 39% similar to YBIT_ECOLI; and residues 14-527 are 37% similar to (AE000596) ABC transporter, ATP-binding protein (yheS) [Helicobacter pylori 26695].

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
Residues 33-185 span four regions of similarity to blocks BL00211A,B (ABC transporters family proteins) with an E-value of 1.1e-13.

ProDom Summary:  Protein Domain Search
Residues 63-145 are 45% similar to a defined domain of YBIT_ECOLI, defined as: ATP-BINDING PROTEIN ABC TRANSPORTER YHES YKPA YBIT TRANSPORT REPEAT.
Residues 20-61 are 61% similar to a defined domain of O51684_BORBU, defined as: ATP-BINDING TRANSPORT PROTEIN TRANSPORTER ABC TRANSMEMBRANE MEMBRANE INNER RESISTANCE GLYCOPROTEIN.

Paralogs:  Local Blast Search
Possible paralogs include ABC transporter proteins: CPn0413, CPn0280, CPn0542, CPn0202, CPn0348, CPn0723, CPn0201, CPn0191, CPn248, CPn691, CPn683, and CPn231. Residues 329-512 are 29% similar to CPn0413.

Pfam Summary:  Pfam Search
Residues 28 to 226 (E-value = 3.1e-33) place CPn0023 in the ABC_tran family which is described as ABC transporter (PF00005)
Residues 343 to 510 (E-value = 7e-33) place CPn0023 in the ABC_tran family which is described as ABC transporter (PF00005)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
244  
326

PDB Hit:


Gene Protein Sequence:
MSIVLDKIGKSLGTRILFDDVSVVFNPGNCYGLTGPNGAGKSTLLKIIMG
MIEPTRGSISLPKKVGILRQNIDSFHDTTVLDCVIMGNTRLWEALQRRDN
LYLQEFTDAIGMELGEIEEIIGEENGYRADSEAEELLTGIGIPNEMFDKK
MAMIPIDLQFRVLLCQALFGHPEALLLDEPTNHLDLYSINWLGNFLKDYE
GTVIVVSHDRHFLNTITTHIADIDYDTIIIYPGNYDDMVEMKTASREQEK
ADIKSKEKKISQLKEFVAKFGAGSRASQVQSRLREIKKLQPQELKKSNIQ
RPYIRFPLSDKSSGKVVLSLEAITKDYGDHQVIHPFSLEIYQGDKLGIIG
NNGLGKTTLMKLLAGVEAPSSGSIKLGHQAICSYFPQNHSDVLADCGQET
LFEWLRNRKTGINDQEIRSVLGKMLFGGDDAFKQIQALSGGETARLLMAG
MMLENHNVLILDEANNHLDLESVSALSWAINDYKGTAIFVSHDRGLIQDC
ATKLLIFDKDKITFFDGTMVDYTAGHKQLL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGCATAGTATTAGATAAAATTGGCAAATCTTTAGGCACTCGAATTTT
ATTCGATGATGTTTCCGTCGTTTTCAACCCCGGGAACTGCTACGGTCTTA
CTGGTCCTAACGGCGCAGGAAAGTCCACCCTTTTAAAAATCATTATGGGA
ATGATAGAACCTACAAGAGGTTCGATTTCCTTACCTAAAAAAGTGGGGAT
CCTGCGTCAAAATATCGATAGCTTTCACGACACAACAGTCTTAGATTGTG
TCATTATGGGAAATACTCGTCTTTGGGAAGCTTTACAACGCCGTGATAAT
CTCTATCTACAAGAATTTACTGACGCCATTGGAATGGAGCTTGGTGAAAT
TGAAGAGATCATCGGCGAGGAAAATGGGTACCGAGCAGATTCAGAAGCCG
AAGAACTCCTCACAGGCATTGGCATCCCCAATGAGATGTTTGATAAGAAA
ATGGCTATGATTCCCATAGACCTACAATTTCGAGTTCTTCTTTGCCAGGC
TCTCTTTGGTCACCCCGAAGCACTTCTTCTTGATGAGCCAACAAACCACT
TGGACCTCTATTCCATTAATTGGCTGGGAAACTTTTTAAAAGATTATGAA
GGCACTGTCATTGTAGTCAGTCACGACCGTCATTTCTTAAATACAATTAC
GACTCACATTGCTGACATTGATTACGACACGATCATTATCTACCCTGGAA
ACTATGACGATATGGTAGAGATGAAAACCGCGTCTCGCGAGCAAGAAAAG
GCCGACATCAAATCTAAGGAAAAGAAAATTTCTCAGCTTAAGGAATTTGT
TGCTAAATTTGGTGCGGGATCACGAGCGAGTCAAGTGCAGTCTCGATTAA
GAGAGATTAAGAAGCTTCAGCCACAAGAATTAAAAAAATCCAATATCCAA
CGTCCTTACATTCGTTTCCCCCTATCTGACAAATCCTCAGGGAAAGTCGT
TTTGTCTTTAGAAGCGATTACAAAGGATTATGGGGATCATCAGGTAATCC
ATCCTTTTTCTTTAGAGATTTATCAAGGAGACAAGCTTGGTATTATCGGG
AACAATGGATTGGGTAAAACTACATTAATGAAGTTACTTGCAGGTGTTGA
GGCTCCTTCTTCAGGAAGTATCAAGTTAGGCCATCAAGCTATCTGTTCAT
ATTTTCCTCAAAACCACAGCGATGTTCTAGCTGATTGTGGTCAAGAAACG
CTATTTGAGTGGCTACGCAATCGCAAAACCGGAATTAACGATCAAGAAAT
CCGCAGTGTGTTAGGGAAAATGCTTTTTGGAGGCGATGATGCTTTCAAGC
AAATCCAAGCATTATCTGGAGGAGAAACAGCTCGTCTTCTCATGGCGGGG
ATGATGCTAGAAAACCATAATGTCCTTATCCTTGATGAAGCGAACAACCA
CTTAGACTTAGAGTCTGTGTCTGCTCTTTCTTGGGCTATCAATGACTATA
AGGGCACAGCGATTTTTGTCTCTCACGACAGAGGACTGATTCAAGATTGT
GCTACGAAGTTATTGATCTTTGATAAAGATAAGATTACATTCTTCGATGG
AACTATGGTAGACTATACTGCAGGTCATAAGCAATTGTTGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy