Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR14 IGR15 IGR16 IGR17 IGR19 IGR18 IGR13 CPn0026 CPn0025 xerC, - CPn0024 yjjK, - CPn0023 CPn0021 CPn0020 CPn0026 CPn0025 xerC, - CPn0024 yjjK, - CPn0023 CPn0021 CPn0020 CPn0026 CPn0025 xerC, - CPn0024 yjjK, - CPn0023 CPn0021 CPn0020 maf, - CPn0022 maf, - CPn0022
* Calculated from Protein Sequence

Gene ID: CPn0022

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
maf  

Definition:
MAF protein (MAF/YMDE/YCEF related)

Gene Start:
34982

Gene Stop:
34392

Gene Length:
591

Molecular Weight*:
21735

pI*:
6.50

Net Charge*:
-1.80

EC:
 

Functional Class:
uncategorized  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0022 is orthologously related to CT349: residues 1-196 of CPn0022 are 46% similar to residues 1-196 of CT349, a predicted MAF protein (MAF/YMDE/YCEF related) from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 3 to 195 (E-value = 9.9e-107) place CPn0022 in the Maf family which is described as Maf-like protein (PF02545)

PDB Hit:


Gene Protein Sequence:
MSLPLVLGSSSPRRKFILEKFRVPFTVIPSNFDESKVSYSGDPIAYTQEL
AAQKAYAVSELHSPCDCIILTGDTIVSYDGRIFTKPQDKADAIQMLKTLR
NQTHDVVTSIAVLHKGKLLTGSETSQISLTMIPDHRIESYIDTVGTLNNC
GAYDVCHGGLILKKVHGCVYNVQGLPIQTLKYLLEELNIDLWDYSI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCCCTTCCTTTAGTTTTAGGGTCTTCTTCGCCAAGAAGAAAATTTAT
TTTAGAAAAATTTCGTGTTCCCTTTACTGTCATTCCTTCAAATTTTGATG
AGAGTAAAGTCAGCTACTCTGGGGATCCTATAGCCTATACACAAGAACTT
GCCGCACAAAAGGCCTATGCAGTTTCTGAGCTACATTCGCCTTGTGACTG
TATTATCCTCACTGGCGATACTATTGTTTCTTACGATGGCCGTATTTTCA
CAAAACCTCAAGACAAAGCAGACGCTATCCAGATGTTAAAGACCTTGAGG
AATCAGACGCATGATGTGGTCACGAGTATTGCCGTATTACATAAGGGAAA
ACTCCTCACAGGGTCAGAGACTTCTCAGATTTCACTTACTATGATTCCTG
ATCACCGCATAGAGTCTTATATCGACACTGTAGGAACATTAAATAATTGT
GGCGCTTATGACGTTTGCCATGGTGGCTTGATTTTGAAAAAGGTCCATGG
ATGTGTTTATAATGTTCAAGGTCTCCCTATCCAAACATTGAAATACTTGC
TAGAGGAGTTGAACATCGATCTATGGGACTATTCCATCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy