Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR14 IGR15 IGR16 IGR17 IGR13 CPn0025 xerC, - CPn0024 yjjK, - CPn0023 CPn0021 CPn0020 CPn0025 xerC, - CPn0024 yjjK, - CPn0023 CPn0021 CPn0020 CPn0025 xerC, - CPn0024 yjjK, - CPn0023 CPn0021 CPn0020 maf, - CPn0022 maf, - CPn0022
* Calculated from Protein Sequence

Gene ID: CPn0021

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein (predicted OMP)

Gene Start:
34410

Gene Stop:
32704

Gene Length:
1707

Molecular Weight*:
63543

pI*:
7.70

Net Charge*:
3.23

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
CPn0021 is orthologously related to CT350, a hypothetical protein and they share 52% similarity.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No evidence of paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
22
non-globular  
67  
148
non-globular  
222  
356

PDB Hit:


Gene Protein Sequence:
MGLFHLTLFGLLLCSLPISLVAKFPESVGHKILYISTQSTQQALATYLEA
LDAYGDHDFFVLRKIGEDYLKQSIHSSDPQTRKSTIIGAGLAGSSEALDV
LSQAMETADPLQQLLVLSAVSGHLGKTSDDLLFKALASPYPVIRLEAAYR
LANLKNTKVIDHLHSFIHKLPEEIQCLSAAIFLRLETEESDAYIRDLLAA
KKSAIRSATALQIGEYQQKRFLPTLRNLLTSASPQDQEAILYALGKLKDG
QSYYNIKKQLQKPDVDVTLAAAQALIALGKEEDALPVIKKQALEERPRAL
YALRHLPSEIGIPIALPIFLKTKNSEAKLNVALALLELGCDTPKLLEYIT
ERLVQPHYNETLALSFSKGRTLQNWKRVNIIVPQDPQERERLLSTTRGLE
EQILTFLFRLPKEAYLPCIYKLLASQKTQLATTAISFLSHTSHQEALDLL
FQAAKLPGEPIIRAYADLAIYNLTKDPEKKRSLHDYAKKLIQETLLFVDT
ENQRPHPSMPYLRYQVTPESRTKLMLDILETLATSKSSEDIRLLIQLMTE
GDAKNFPVLAGLLIKIVE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGACTATTCCATCTAACTCTCTTTGGACTTTTATTGTGTAGTCTTCC
CATTTCTCTTGTTGCTAAATTCCCTGAGTCTGTAGGTCATAAGATCCTTT
ATATAAGTACGCAATCTACACAGCAGGCCTTAGCAACATATCTGGAAGCT
CTAGATGCCTACGGTGATCATGACTTCTTCGTTTTAAGAAAAATCGGAGA
AGACTATCTCAAGCAAAGCATCCACTCCTCAGATCCGCAAACTAGAAAAA
GCACCATCATTGGAGCAGGCCTGGCGGGATCTTCAGAAGCCTTGGACGTG
CTCTCCCAAGCTATGGAAACTGCAGACCCCCTGCAGCAGCTACTGGTTTT
ATCGGCAGTCTCAGGACATCTTGGGAAAACTTCTGACGACTTACTGTTTA
AAGCTTTAGCATCTCCCTATCCTGTCATCCGCTTAGAAGCCGCCTATAGA
CTTGCTAATTTGAAGAACACTAAAGTCATTGATCATCTACATTCTTTCAT
TCATAAGCTTCCCGAAGAAATCCAATGCCTATCTGCGGCAATATTCCTAC
GCTTGGAGACTGAAGAATCTGATGCTTATATTCGGGATCTCTTAGCTGCC
AAGAAAAGCGCGATTCGGAGTGCCACAGCTTTGCAGATCGGAGAATACCA
ACAAAAACGCTTTCTTCCGACACTTAGGAATTTGCTAACGAGTGCGTCTC
CTCAAGATCAAGAAGCTATTCTTTATGCTTTAGGGAAGCTTAAGGATGGT
CAGAGCTACTACAATATAAAAAAGCAATTGCAGAAGCCTGATGTGGATGT
CACTTTAGCAGCAGCTCAAGCTTTAATTGCTTTGGGGAAAGAAGAGGACG
CTCTTCCCGTGATAAAAAAGCAAGCACTTGAGGAGCGGCCTCGAGCCCTG
TATGCCTTACGGCATCTACCCTCTGAGATAGGGATTCCGATTGCCCTGCC
GATATTCCTAAAAACTAAGAACAGCGAAGCCAAGTTGAATGTAGCTTTAG
CTCTCTTAGAGTTAGGGTGTGACACCCCTAAACTACTGGAATACATTACC
GAAAGGCTTGTCCAACCACATTATAATGAGACTCTAGCCTTGAGTTTCTC
TAAGGGGCGTACTTTACAAAATTGGAAGCGGGTGAACATCATAGTCCCTC
AAGATCCCCAGGAGAGGGAAAGGTTGCTCTCCACAACCCGAGGTCTTGAA
GAGCAGATCCTTACGTTTCTCTTCCGCCTACCTAAAGAAGCTTACCTCCC
CTGTATTTATAAGCTTTTGGCGAGTCAGAAAACTCAGCTTGCCACTACTG
CGATTTCTTTTTTAAGTCACACCTCACATCAGGAAGCCTTAGATCTACTT
TTCCAAGCTGCGAAGCTTCCTGGAGAACCTATCATCCGCGCCTATGCAGA
TCTTGCTATTTATAATCTCACCAAAGATCCTGAAAAAAAACGTTCTCTCC
ATGATTATGCAAAAAAGCTAATTCAGGAAACCTTGTTATTTGTGGACACG
GAAAACCAAAGACCCCATCCCAGCATGCCCTATCTACGTTATCAGGTCAC
CCCAGAAAGCCGTACGAAGCTCATGTTGGATATTCTAGAGACACTAGCCA
CCTCGAAGTCTTCCGAAGATATCCGTTTATTGATACAACTGATGACGGAA
GGAGATGCAAAAAATTTCCCAGTCCTTGCAGGCTTACTCATAAAAATTGT
GGAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy