Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR11 IGR10 IGR12 IGR13 CPn0011 CPn0010.1 CPn0012 pmpG, - CPn0013 CPn0011 CPn0010.1 CPn0012 pmpG, - CPn0013 Type: direct, Name:  - 18 CPn0011 CPn0010.1 CPn0012 pmpG, - CPn0013
* Calculated from Protein Sequence

Gene ID: CPn0013

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pmpG  

Definition:
outer membrane protein G

Gene Start:
18584

Gene Stop:
21109

Gene Length:
2526

Molecular Weight*:
89595

pI*:
6.40

Net Charge*:
-4.29

EC:
 

Functional Class:
cell envelope; membranes, lipoproteins and porins  

Pathway: pathway table

Comment:
Note that both CPn0005 and CPn0013 have best hits to CT871.

Blast Summary:  PSI-Blast Search
No similarities to M. genitalium, T. pallidum, or U. urealyticum sequences.

CPn0013 is similar to CT871, CT874, CT869, CT413, CT872, CT412, CT812,
CT414, and CT870. They are all predicted outer membrane proteins. Residues 17-841 of CPn0013 are 28% similar to CT871.



COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CP0013 is paralogously related to 16 polymorphic outer membrane proteins: CPn0451, CPn0447, CPn0446, CPn0445, CPn0444, CPn0005, CPn0452, CPn0539, CPn0963, CPn0467, CPn0471, CPn-454, CPn0466, CPn0470.

Pfam Summary:  Pfam Search
Residues 2 to 428 (E-value = 2.5e-182) place CPn0013 in the Chlam_PMP family which is described as Chlamydia polymorphic membrane protein (Chlamydia_PMP) (PF02415)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
24
non-globular  
25  
317

PDB Hit:


Gene Protein Sequence:
MKIPLRFLLISLVPTLSMSNLLGAATTEELSASNSFDGTTSTTSFSSKTS
SATDGTNYVFKDSVVIENVPKTGETQSTSCFKNDAAAGDLNFLGGGFSFT
FSNIDATTASGAAIGSEAANKTVTLSGFSALSFLKSPASTVTNGLGAINV
KGNLSLLDNDKVLIQDNFSTGDGGAINCAGSLKIANNKSLSFIGNSSSTR
GGAIHTKNLTLSSGGETLFQGNTAPTAAGKGGAIAIADSGTLSISGDSGD
IIFEGNTIGATGTVSHSAIDLGTSAKITALRAAQGHTIYFYDPITVTGST
SVADALNINSPDTGDNKEYTGTIVFSGEKLTEAEAKDEKNRTSKLLQNVA
FKNGTVVLKGDVVLSANGFSQDANSKLIMDLGTSLVANTESIELTNLEIN
IDSLRNGKKIKLSAATAQKDIRIDRPVVLAISDESFYQNGFLNEDHSYDG
ILELDAGKDIVISADSRSIDAVQSPYGYQGKWTINWSTDDKKATVSWAKQ
SFNPTAEQEAPLVPNLLWGSFIDVRSFQNFIELGTEGAPYEKRFWVAGIS
NVLHRSGRENQRKFRHVSGGAVVGASTRMPGGDTLSLGFAQLFARDKDYF
MNTNFAKTYAGSLRLQHDASLYSVVSILLGEGGLREILLPYVSKTLPCSF
YGQLSYGHTDHRMKTESLPPPPPTLSTDHTSWGGYVWAGELGTRVAVENT
SGRGFFQEYTPFVKVQAVYARQDSFVELGAISRDFSDSHLYNLAIPLGIK
LEKRFAEQYYHVVAMYSPDVCRSNPKCTTTLLSNQGSWKTKGSNLARQAG
IVQASGFRSLGAAAELFGNFGFEWRGSSRSYNVDAGSKIKF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGATTCCACTCCGCTTTTTATTGATATCATTAGTACCTACGCTTTC
TATGTCGAATTTATTAGGAGCTGCTACTACCGAAGAGTTATCGGCTAGCA
ATAGCTTCGATGGAACTACATCAACAACAAGCTTTTCTAGTAAAACATCA
TCGGCTACAGATGGCACCAATTATGTTTTTAAAGATTCTGTAGTTATAGA
AAATGTACCCAAAACAGGGGAAACTCAGTCTACTAGTTGTTTTAAAAATG
ACGCTGCAGCTGGAGATCTAAATTTCTTAGGAGGGGGATTTTCTTTCACA
TTTAGCAATATCGATGCAACCACGGCTTCTGGAGCTGCTATTGGAAGTGA
AGCAGCTAATAAGACAGTCACGTTATCAGGATTTTCGGCACTTTCTTTTC
TTAAATCCCCAGCAAGTACAGTGACTAATGGATTGGGAGCTATCAATGTT
AAAGGGAATTTAAGCCTATTGGATAATGATAAGGTATTGATTCAGGACAA
TTTCTCAACAGGAGATGGCGGAGCAATTAATTGTGCAGGCTCCTTGAAGA
TCGCAAACAATAAGTCCCTTTCTTTTATTGGAAATAGTTCTTCAACACGT
GGCGGAGCGATTCATACCAAAAACCTCACACTATCTTCTGGTGGGGAAAC
TCTATTTCAGGGGAATACAGCGCCTACGGCTGCTGGTAAAGGAGGTGCTA
TCGCGATTGCAGACTCTGGCACCCTATCCATTTCTGGAGACAGTGGCGAC
ATTATCTTTGAAGGCAATACGATAGGAGCTACAGGAACCGTCTCTCATAG
TGCTATTGATTTAGGAACTAGCGCTAAGATAACTGCGTTACGTGCTGCGC
AAGGACATACGATATACTTTTATGATCCGATTACTGTAACAGGATCGACA
TCTGTTGCTGATGCTCTCAATATTAATAGCCCTGATACTGGAGATAACAA
AGAGTATACGGGAACCATAGTCTTTTCTGGAGAGAAGCTCACGGAGGCAG
AAGCTAAAGATGAGAAGAACCGCACTTCTAAATTACTTCAAAATGTTGCT
TTTAAAAATGGGACTGTAGTTTTAAAAGGTGATGTCGTTTTAAGTGCGAA
CGGTTTCTCTCAGGATGCAAACTCTAAGTTGATTATGGATTTAGGGACGT
CGTTGGTTGCAAACACCGAAAGTATCGAGTTAACGAATTTGGAAATTAAT
ATAGACTCTCTCAGGAACGGGAAAAAGATAAAACTCAGTGCTGCCACAGC
TCAGAAAGATATTCGTATAGATCGTCCTGTTGTACTGGCAATTAGCGATG
AGAGTTTTTATCAAAATGGCTTTTTGAATGAGGACCATTCCTATGATGGG
ATTCTTGAGTTAGATGCTGGGAAAGACATCGTGATTTCTGCAGATTCTCG
CAGTATAGATGCTGTACAATCTCCGTATGGCTATCAGGGAAAGTGGACGA
TCAATTGGTCTACTGATGATAAGAAAGCTACGGTTTCTTGGGCGAAGCAG
AGTTTTAATCCCACTGCTGAGCAGGAGGCTCCGTTAGTTCCTAATCTTCT
TTGGGGTTCTTTTATAGATGTTCGTTCCTTCCAGAATTTTATAGAGCTAG
GTACTGAAGGTGCTCCTTACGAAAAGAGATTTTGGGTTGCAGGCATTTCC
AATGTTTTGCATAGGAGCGGTCGTGAAAATCAAAGGAAATTCCGTCATGT
GAGTGGAGGTGCTGTAGTAGGTGCTAGCACGAGGATGCCGGGTGGTGATA
CCTTGTCTCTGGGTTTTGCTCAGCTCTTTGCGCGTGACAAAGACTACTTT
ATGAATACCAATTTCGCAAAGACCTACGCAGGATCTTTACGTTTGCAGCA
CGATGCTTCCCTATACTCTGTGGTGAGTATCCTTTTAGGAGAGGGAGGAC
TCCGCGAGATCCTGTTGCCTTATGTTTCCAAGACTCTGCCGTGCTCTTTC
TATGGGCAGCTTAGCTACGGCCATACGGATCATCGCATGAAGACCGAGTC
TCTACCCCCCCCCCCCCCGACGCTCTCGACGGATCATACTTCTTGGGGAG
GATATGTCTGGGCTGGAGAGCTGGGAACTCGAGTTGCTGTTGAAAATACC
AGCGGCAGAGGATTTTTCCAAGAGTACACTCCATTTGTAAAAGTCCAAGC
TGTTTACGCTCGCCAAGATAGCTTTGTAGAACTAGGAGCTATCAGTCGTG
ATTTTAGTGATTCGCATCTTTATAACCTTGCGATTCCTCTTGGAATCAAG
TTAGAGAAACGGTTTGCAGAGCAATATTATCATGTTGTAGCGATGTATTC
TCCAGATGTTTGTCGTAGTAACCCCAAATGTACGACTACCCTACTTTCCA
ACCAAGGGAGTTGGAAGACCAAAGGTTCGAACTTAGCAAGACAGGCTGGT
ATTGTTCAGGCCTCAGGTTTTCGATCTTTGGGAGCTGCAGCAGAGCTTTT
CGGGAACTTTGGCTTTGAATGGCGGGGATCTTCTCGTAGCTATAATGTAG
ATGCGGGTAGCAAAATCAAATTTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy