Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR11 IGR9 IGR10 IGR8 IGR12 IGR13 CPn0011 CPn0010 CPn0009 CPn0010.1 CPn0012 pmpG, - CPn0013 CPn0011 CPn0010 CPn0009 CPn0010.1 CPn0012 pmpG, - CPn0013 Type: direct, Name:  - 13 Type: direct, Name:  - 18 Type: direct, Name:  - 19 CPn0011 CPn0010 CPn0009 CPn0010.1 CPn0012 pmpG, - CPn0013
* Calculated from Protein Sequence

Gene ID: CPn0012

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
16644

Gene Stop:
18215

Gene Length:
1572

Molecular Weight*:
62450

pI*:
5.10

Net Charge*:
-15.77

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
In addition to the hits to C.pneumoniae sequences, numerous weak hits to myosin heavy chain sequences; e.g. residues 156-397 are 23% similar to (U64862) strong similarity to Onchocerca volvulus major antigen (SP:P212249) [Caenorhabditis elegans]; residues 147-269 are 29% similar and residues 136-427 are 23% similar to (U31463) nonmuscle myosin heavy chain-A [Rattus norvegicus]; and residues 147-469 are 23% similar to MYSN_CHICK.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 123-290 are 29% similar to a defined domain of CENE_HUMAN, defined as: Centromeric protein E (CenP-E PROTEIN). Motor protein; cell division; ATP-binding; coiled coil; mitosis; cell cycle; centromere.


Paralogs:  Local Blast Search
Numerous significant hits in gapped BLAST to hypothetical protein sequences in C.pneumoniae. These probable paralogs in order of similarity are: CPn0126, CPn0007, CPn1054, CPn0009, CPn0045, CPn0043, CPn0042, and CPn0010.1.

Residues 8-523 are 25% similar to residues 241-756 of CPn0126.
Residues 1-484 are 25% similar to residues 469-957 of CPn0007.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
110  
263
non-globular  
267  
341
coil-coil  
352  
423
coil-coil  
462  
493

PDB Hit:


Gene Protein Sequence:
MYQENLRLLERLLYNSVQKSYADRLFSYEKTKMVHDTPLIPWEEDKEKCA
EAEKAFLEQQKILLDYGKSIFWLNENDEINLNDPWSWGLNTVRTRKVFQE
VDDSERWNHKVLIQKLEDDYEKLLEESSKESTEANKKLLSDLVDRLEDAK
TKFFLKKQEEVETRVKDLRARYGGTVDPKQDTEAKKKVELEASLETFLDS
IESELVQCLEDQDIYWKEQDVKDLARTQELEEQDIEAKREEAAEDLRSLN
ERLKKSKTMLDRAKWHIENAEDSITWWTSQIEMKDMKARLKILKEDITSV
LPEIDEIETCLSLEELPLLTTRELLTKSYLKFKICSETLLKMTSVFENNI
YVQEYEVQLQNLGFKLQGISQRFGKKQDDFANLEEQVALQKKRLRELTQN
FEIQGFNFMKEDFKAAAKDLYIRSTAEQKMNFDVPCMELFRRYHEEVNKP
LLELMYNCADSYRDAKKKLCSLRLDEKELLQKEIKKEEFYQKKQQRHADR
SRHTTYQKLRIAEELALELKKKI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTACCAGGAGAATCTAAGATTGTTGGAAAGGCTTCTTTATAATAGTGT
TCAAAAGAGCTATGCGGATCGGCTGTTTTCCTATGAAAAGACAAAGATGG
TGCACGATACTCCGCTGATTCCTTGGGAAGAGGATAAGGAAAAATGTGCT
GAAGCTGAGAAAGCTTTCTTAGAGCAACAGAAGATTCTCCTAGATTATGG
AAAATCTATCTTTTGGCTGAATGAGAACGATGAGATCAATTTAAACGATC
CTTGGAGTTGGGGTCTTAATACGGTGAGGACTAGGAAAGTATTCCAAGAG
GTTGACGACAGTGAACGTTGGAATCATAAGGTACTCATTCAAAAACTCGA
GGACGATTATGAGAAACTTCTAGAGGAAAGTTCAAAAGAGTCTACTGAAG
CAAATAAGAAGCTTTTATCTGACTTAGTAGATCGTCTTGAAGATGCTAAG
ACAAAATTTTTCCTGAAGAAACAGGAGGAGGTGGAGACTCGCGTTAAGGA
TCTTAGAGCTCGATATGGAGGCACAGTAGATCCTAAGCAGGATACGGAAG
CTAAGAAGAAAGTCGAATTGGAGGCTAGCTTAGAAACCTTTTTAGATTCC
ATCGAATCAGAGCTAGTACAGTGTTTAGAAGATCAAGATATATATTGGAA
AGAACAGGATGTCAAAGATCTAGCACGTACGCAAGAGCTCGAGGAACAAG
ATATTGAAGCGAAGAGGGAAGAAGCTGCCGAAGACCTAAGAAGTCTTAAT
GAGCGTTTAAAGAAGTCAAAAACTATGTTAGATAGGGCTAAATGGCATAT
TGAAAATGCTGAGGACAGTATTACCTGGTGGACTAGTCAGATAGAAATGA
AGGATATGAAAGCAAGACTGAAGATCTTAAAAGAAGATATAACAAGTGTT
CTACCTGAAATAGATGAGATTGAAACGTGTTTAAGCTTAGAGGAGCTTCC
TTTGCTTACGACCAGGGAACTCTTAACTAAGTCCTACCTAAAGTTTAAGA
TTTGTTCGGAAACACTATTAAAAATGACTTCTGTGTTTGAGAACAATATC
TATGTTCAGGAGTACGAGGTTCAGCTGCAAAATCTAGGGTTTAAGTTACA
AGGTATATCTCAGAGATTCGGAAAGAAACAAGACGATTTTGCGAATCTAG
AGGAACAGGTTGCTTTGCAAAAGAAACGACTCAGAGAGCTCACTCAGAAT
TTTGAAATACAAGGATTCAATTTCATGAAAGAAGATTTTAAGGCAGCCGC
TAAAGATCTTTATATAAGAAGTACAGCTGAACAAAAGATGAACTTTGATG
TGCCTTGCATGGAGCTCTTCCGTAGGTATCATGAGGAGGTCAACAAGCCG
CTTCTTGAGTTGATGTACAATTGTGCAGACAGTTATAGAGATGCTAAGAA
AAAGCTTTGCTCTCTACGTCTTGATGAAAAAGAGTTATTACAAAAAGAAA
TCAAGAAAGAGGAATTTTATCAAAAGAAACAACAAAGGCATGCAGATAGA
TCACGTCATACTACGTATCAAAAGCTACGAATTGCTGAAGAGCTTGCTCT
TGAGCTGAAGAAGAAAATCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy