Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR11 IGR9 IGR7 IGR10 IGR8 IGR12 IGR13 CPn0008 CPn0011 CPn0010 CPn0009 CPn0010.1 CPn0012 pmpG, - CPn0013 CPn0008 CPn0011 CPn0010 CPn0009 CPn0010.1 CPn0012 pmpG, - CPn0013 Type: direct, Name:  - 13 Type: direct, Name:  - 18 Type: direct, Name:  - 19 CPn0008 CPn0011 CPn0010 CPn0009 CPn0010.1 CPn0012 pmpG, - CPn0013
* Calculated from Protein Sequence

Gene ID: CPn0011

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
15892

Gene Stop:
16617

Gene Length:
726

Molecular Weight*:
26666

pI*:
5.00

Net Charge*:
-5.60

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
Thought to contribute to pathogenesis.

Blast Summary:  PSI-Blast Search
This is a C. pneumoniae-specific protein with no similarities to a known sequence in any other organism.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0011 is similar to many Chlamydia-specific hypothetical proteins (CPn0124, CPn1054, CPn0043, CPn0126, etc.).

Pfam Summary:  Pfam Search
Residues 40 to 241 (E-value = 4.8e-94) place CPn0011 in the DUF256 family which is described as Protein of unknown function, DUF256 (PF03191)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
34  
58
transmembrane  
63  
82
coil-coil  
85  
170

PDB Hit:


Gene Protein Sequence:
MTAAPAILHVSPTPPEETKFVIPKDSKSRALGITLLVVGILLVVCGAIVL
SGVISGLSALIVCGLGISTISLGVVLFVLGLILLLRKRELTLEQIEAKQI
AETFADELKELEMYIQSTEKSLEKIEGSRYSDQGFLNRATQKILDLESSL
SSITSEFRDLRQLFDEEKIELLSGERLLEFIAANLFKQGRDVYLNLGNLA
DIRAYMGPNNYKVAMVIEKAKAVVHEFIVLTTMARELEFFF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACTGCAGCACCAGCTATTCTACACGTATCCCCGACACCCCCTGAAGA
AACAAAATTCGTTATTCCTAAAGATAGTAAATCTCGCGCTCTTGGGATTA
CTTTATTAGTCGTAGGCATCCTTCTGGTAGTTTGTGGTGCGATTGTACTC
AGTGGAGTGATTTCTGGATTGAGTGCACTCATTGTTTGTGGATTGGGTAT
TAGTACGATTTCTCTAGGAGTTGTCCTATTTGTTTTAGGATTGATATTAT
TACTTAGAAAGCGGGAACTTACCTTAGAACAGATCGAGGCTAAGCAAATT
GCGGAGACCTTTGCTGATGAACTGAAAGAACTAGAAATGTACATTCAGTC
GACAGAGAAAAGCTTAGAGAAGATAGAAGGGTCCCGTTATAGTGACCAAG
GTTTTCTGAATCGTGCCACCCAAAAAATCTTAGATTTAGAATCTTCATTG
AGCTCTATTACTTCTGAGTTTCGTGATCTTAGGCAACTCTTTGATGAAGA
AAAAATAGAGTTACTTTCTGGAGAAAGGCTTTTAGAATTTATTGCAGCGA
ATTTATTTAAACAAGGAAGAGATGTCTATTTAAATTTAGGGAATTTAGCA
GACATTCGTGCGTACATGGGGCCCAACAATTATAAAGTTGCGATGGTCAT
AGAAAAAGCTAAAGCAGTTGTGCATGAGTTTATAGTTCTGACTACAATGG
CTAGGGAATTAGAGTTTTTTTTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy