Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR11 IGR9 IGR7 IGR10 IGR8 IGR12 IGR6 CPn0008 CPn0011 CPn0010 CPn0009 CPn0010.1 CPn0012 pmpG, - CPn0013 CPn0007 CPn0008 CPn0011 CPn0010 CPn0009 CPn0010.1 CPn0012 pmpG, - CPn0013 CPn0007 Type: direct, Name:  - 13 Type: direct, Name:  - 18 Type: direct, Name:  - 19 CPn0008 CPn0011 CPn0010 CPn0009 CPn0010.1 CPn0012 pmpG, - CPn0013 CPn0007
* Calculated from Protein Sequence

Gene ID: CPn0010.1

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
14379

Gene Stop:
15749

Gene Length:
1371

Molecular Weight*:
54255

pI*:
5.80

Net Charge*:
-6.07

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of C. pneumoniae except some similarity to eukaryotic proteins such as the hyaluronan receptor RHAMMV5 from Mus musculus (AF079222), trichohyalin from rabbit (P37709), myosin heavy chain from human (D86970), among others.
No significant similarity to C. trachomatis, M. genitalium, T. pallidum, or U. urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Numerous significant hits to probable paralogs in C. pneumoniae, all of which are predicted hypothetical proteins. In order of similarity they are:

CPn1054, CPn0009, CPn0042, CPn0043, CPn0045, CPn1056, CPn0046, CPn0126, CPn0007, CPn0044, CPn0041, and CPn0012.

Residues 1-456 are 95% similar to residues 353-811 of CPn1054.
Residues 76-308 are 21% similar to residues 238-474 of CPn1054.
Residues 7-427 are 46% similar to residues 13-435 of CPn0009.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
25  
138
coil-coil  
152  
202
coil-coil  
290  
317

PDB Hit:


Gene Protein Sequence:
VLDPYRQERMDEITFHELYEKTTFLKRLHRKCALAKTTFEKKRSKKNLQA
VEEANARRLKYVRDWYDQEFQKAGERLEKLHALYPEVSVSIRENKIQETR
SNLEKAYEAIEENYRCCVREQEDYWKEEEKREAEFRERGNKILSPEELES
SLEQFDHGLKNFSEKLMELEGHILKLQKEATAEVENKILSDAESRLEIVF
EDVKEMPCRIEEIEKTLRMAELPLLPTKKAFEKACSQYNSCAEMLEKVKP
YCKESLAYVTSKERLVSLDEDLRRAYTECQKRFQGDSGLESEVRACREQL
RERIQEFETQGLDLVEKELLCVSSRLRNTECDCVSGVKKEAPPGKKFYAQ
YYDEIYRVRVQSRWMTMSERLREGVQACNKMLKAGLSEEDKVLKEEEYWL
YREERKNKEKRLVGTKIVATQQRIQEFQPSDIVESSNEKVSLMDKARFLF
NREDHS$

Gene Nucleotide Sequence:  Sequence Viewer
GTGCTTGATCCTTATAGACAAGAGAGAATGGACGAGATAACGTTCCATGA
GTTGTATGAAAAAACTACGTTTTTGAAAAGACTGCACAGAAAGTGTGCGT
TAGCGAAAACAACCTTTGAAAAGAAGAGATCTAAAAAGAATTTGCAGGCA
GTCGAGGAGGCGAATGCACGTAGGTTGAAATATGTAAGGGATTGGTATGA
TCAGGAGTTTCAGAAAGCAGGGGAGAGATTAGAGAAACTGCATGCTTTGT
ATCCTGAGGTTTCAGTCTCTATAAGAGAGAACAAAATACAAGAGACGCGC
TCTAATTTAGAGAAAGCCTATGAGGCTATCGAAGAGAACTATCGTTGCTG
TGTCCGAGAGCAAGAGGACTACTGGAAAGAAGAAGAGAAAAGGGAAGCGG
AGTTTAGGGAGAGGGGAAACAAGATTCTTTCTCCTGAGGAGCTGGAAAGT
TCTTTGGAGCAATTCGACCATGGTTTGAAAAATTTTTCTGAGAAATTAAT
GGAATTGGAAGGGCATATCTTAAAACTTCAGAAAGAAGCCACAGCAGAGG
TGGAGAATAAAATACTTTCAGATGCAGAGAGCCGCCTTGAGATTGTATTT
GAAGATGTCAAGGAGATGCCCTGTCGAATTGAGGAGATAGAGAAGACGCT
GCGTATGGCGGAGCTGCCCCTACTTCCTACGAAGAAGGCGTTTGAGAAGG
CCTGCTCACAATATAATAGCTGCGCAGAGATGTTGGAGAAGGTGAAGCCT
TACTGCAAGGAGAGCCTCGCCTATGTGACTAGCAAAGAGCGTTTAGTGAG
CTTGGATGAAGATTTACGACGAGCCTACACAGAGTGTCAGAAGAGATTCC
AGGGGGATTCGGGTTTGGAGTCGGAAGTAAGAGCCTGTCGAGAGCAACTG
CGAGAGCGGATCCAAGAGTTTGAAACTCAAGGGCTGGACTTGGTGGAAAA
AGAGTTGCTTTGTGTGAGTAGTAGATTAAGAAATACAGAGTGCGATTGTG
TATCTGGTGTTAAGAAAGAAGCACCTCCTGGTAAGAAGTTTTATGCCCAG
TATTATGATGAGATTTATCGAGTTAGAGTTCAATCCCGATGGATGACGAT
GTCTGAGAGATTGAGAGAGGGAGTTCAAGCATGCAACAAGATGTTGAAGG
CAGGCCTAAGCGAAGAAGATAAGGTTCTTAAAGAAGAAGAGTATTGGTTG
TATCGAGAGGAGAGAAAGAATAAAGAGAAACGTTTGGTTGGTACTAAGAT
AGTAGCAACGCAGCAGCGGATCCAAGAATTTCAACCATCTGATATCGTTG
AGTCTTCAAATGAGAAAGTGAGCCTTATGGACAAAGCGCGATTTTTATTT
AATCGTGAGGACCATTCCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy