Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR11 IGR9 IGR7 IGR10 IGR8 IGR12 IGR6 CPn0008 CPn0011 CPn0010 CPn0009 CPn0010.1 CPn0012 pmpG, - CPn0013 CPn0007 CPn0008 CPn0011 CPn0010 CPn0009 CPn0010.1 CPn0012 pmpG, - CPn0013 CPn0007 Type: direct, Name:  - 13 Type: direct, Name:  - 18 Type: direct, Name:  - 19 CPn0008 CPn0011 CPn0010 CPn0009 CPn0010.1 CPn0012 pmpG, - CPn0013 CPn0007
* Calculated from Protein Sequence

Gene ID: CPn0010

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
13435

Gene Stop:
14328

Gene Length:
894

Molecular Weight*:
32746

pI*:
6.90

Net Charge*:
-0.20

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of C. pneumoniae sequences.
No similarity to C. trachomatis, M. genitalium, T. pallidum, or U. urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Numerous significant hits to probable paralogs, all of which are predicted hypothetical proteins, in C.pneumoniae. In order of similarity they are:

CPn1054, CPn1055, CPn0041, CPn0045, CPn0043, CPn0008, CPn0007, CPn0124, and CPn0126.

Residues 1-281 are 100% similar, and residues 201-256 are 30% similar to CPn1054.
Residues 1-273 are 64% similar to CPn1055.

Pfam Summary:  Pfam Search
Residues 1 to 216 (E-value = 9e-86) place CPn0010 in the DUF256 family which is described as Protein of unknown function, DUF256 (PF03191)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
16  
40

PDB Hit:


Gene Protein Sequence:
MLLLISGALFLTLGIPGLSAAISFGLGIGLSALGGVLMISGLLCLLVKRE
IPTVRPEEIPEGVSLAPSEEPALQAAQKTLAQLPKELDQLDTDIQEVFAC
LRKLKDSKYESRSFLNDAKKELRVFDFVVEDTLSEIFELRQIVAQEGWDL
NFLINGGRSLMMTAESESLDLFHVSKRLGYLPSGDVRGEGLKKSAKEIVA
RLMSLHCEIHKVAVAFDRNSYAMAEKAFAKALGALEESVYRSLTQSYRDK
FLESERAKIPWNGHITWLRDDAKSGCAEKKLGMPRNVGRNLGKQSFG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTCTTACTGATTTCAGGAGCTCTCTTTCTGACGTTAGGGATTCCAGG
ATTGAGTGCAGCAATTTCTTTTGGATTAGGCATCGGTCTCTCCGCATTAG
GAGGAGTGCTGATGATTTCGGGACTACTATGTCTTTTAGTAAAACGAGAG
ATTCCGACAGTACGACCAGAAGAAATTCCTGAAGGGGTTTCGCTGGCTCC
TTCTGAGGAGCCAGCTCTACAGGCAGCTCAGAAGACTTTAGCTCAGCTGC
CTAAGGAATTGGATCAGTTAGATACAGATATTCAGGAAGTGTTCGCATGT
TTAAGAAAGCTGAAAGATTCTAAGTATGAAAGTCGAAGTTTTTTAAACGA
TGCTAAGAAGGAGCTTCGAGTTTTTGACTTTGTGGTTGAGGATACCCTCT
CGGAGATTTTCGAGTTGCGGCAGATTGTGGCTCAAGAGGGATGGGATTTA
AACTTTTTGATCAATGGGGGACGAAGCCTCATGATGACTGCAGAATCTGA
ATCGCTTGATTTGTTTCATGTATCGAAGCGGCTAGGGTATTTACCTTCTG
GGGATGTTCGAGGGGAGGGGTTAAAGAAATCTGCGAAGGAGATAGTCGCT
CGTTTGATGAGCTTGCATTGCGAGATTCACAAGGTGGCGGTAGCGTTTGA
TAGGAATTCCTATGCGATGGCAGAAAAGGCGTTTGCGAAAGCGTTGGGAG
CTTTAGAAGAGAGTGTGTATCGGAGTCTGACGCAGAGTTATAGAGATAAA
TTTTTGGAGAGCGAGAGGGCGAAGATCCCATGGAATGGGCATATAACCTG
GTTAAGAGATGATGCGAAGAGTGGGTGTGCTGAAAAGAAGCTCGGGATGC
CGAGGAACGTTGGAAGAAATTTAGGAAAGCAGTCTTTTGGGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy