Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR11 IGR9 IGR7 IGR10 IGR5 IGR8 IGR6 CPn0008 CPn0011 CPn0010 CPn0009 CPn0010.1 CPn0012 CPn0007 CPn0008 CPn0011 CPn0010 CPn0009 CPn0010.1 CPn0012 CPn0007 Type: direct, Name:  - 18 Type: tandem, Name:  - 1 Type: direct, Name:  - 19 Type: direct, Name:  - 16 Type: direct, Name:  - 13 Type: direct, Name:  - 16 Type: direct, Name:  - 14 Type: direct, Name:  - 14 CPn0008 CPn0011 CPn0010 CPn0009 CPn0010.1 CPn0012 CPn0007
* Calculated from Protein Sequence

Gene ID: CPn0009

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
11815

Gene Stop:
13122

Gene Length:
1308

Molecular Weight*:
52495

pI*:
6.60

Net Charge*:
-2.17

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:
Other, less significant hits, of this protein to the nr database were to trichohyalin from sheep (accession P22793): 25% similarity over 377 residues with e value of 1e-08 where the e value of this protein to itself and a paralog are 0.0 and 2e-99, respectively. This protein was similar to multiple regions of P22793; yeast proteins S67593 and Z74105 from S. cerevisiae, with similarities among other eukaryotic proteins.

Blast Summary:  PSI-Blast Search
Outside of hits of C. pneumoniae, a single significant hit was found in the STDPRO database to MG218, a predicted adhesin accesory. Residues 7-324 are 21% similar to residues 999-1288 of MG218.
Also, see comment.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 8-305 are 22% similar to a defined domain of Q27181_PARTE, which is defined as: matrix protein trichocyst.

Paralogs:  Local Blast Search
Numerous significant hits to probable paralogs within C. pneumoniae, all of which are predicted hypothetical proteins:

CPn1054, CPn0010.1, CPn0043, CPn0045, CPn0042, CPn1056, CPn0126, CPn0046, CPn0012, CPn0007, and CPn0041.

Residues 13-435 are 47% similar to residues 359-779 of CPn1054.
Residues 13-435 are 46% similar to residues 7-427 of CPn0010.1.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
73  
179
coil-coil  
196  
223

PDB Hit:


Gene Protein Sequence:
MWLDRYADKFILREKEEKMERHELFHATMVRKASGHAYAKAKAAFEKERS
NENQRKVKDVEKWLSKGLAEFRNQESRRARERLRELQTLYPEVSVEERVL
ERQRTKKVNLENLYADIEKKYHHCVREQEHYWKEVENKEAEYRENGEKVL
SAEEVSECLQRLEDCLETWSKKLTKAEESVFEMKFDATEKLGNKVLSDVT
NRLEILCEDAEEMIFRIEEIEMTLRMVELPLLFMKNTFEKASLQYNSCKE
MLAKVEPQCKESPTYRSSQERLERLNQDLQTAYTNCQERLQGFSDLESKV
RTCRDHLREQMKHFEVQGLNFINEELLWVGAELFTQARLDLVATVPYMEF
YLQYHNIKREKVRSQWMAKTERYREIRQAFQGVMKEDLLAEDTILKEEDY
WLLRDDWLLRDERKNRQRRLICNKIAAAQQRVKGF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTGGCTGGATCGTTATGCAGATAAATTTATTTTGAGGGAAAAAGAGGA
AAAGATGGAGCGTCATGAGCTCTTTCATGCGACTATGGTCCGAAAAGCAT
CTGGGCACGCGTATGCTAAAGCTAAAGCAGCCTTTGAAAAGGAGAGATCT
AATGAGAATCAGAGGAAAGTCAAGGATGTTGAAAAATGGTTATCTAAAGG
TTTAGCGGAGTTTCGTAATCAAGAGTCTCGCAGAGCTCGGGAGAGGCTGA
GAGAGCTGCAAACTTTGTATCCTGAGGTTTCTGTAGAAGAGAGAGTGTTA
GAGAGACAAAGGACTAAAAAAGTTAATCTGGAGAACTTGTATGCAGATAT
AGAAAAGAAGTATCACCACTGTGTTCGAGAGCAAGAGCATTACTGGAAAG
AGGTAGAGAACAAGGAAGCAGAGTATAGGGAGAACGGAGAAAAGGTTCTC
TCTGCCGAGGAGGTGTCAGAGTGTCTTCAGAGGTTGGAAGATTGTTTAGA
GACGTGGTCTAAGAAATTAACAAAAGCGGAAGAGAGTGTCTTTGAGATGA
AGTTTGATGCGACAGAAAAACTAGGGAATAAAGTACTTTCTGATGTAACG
AACCGTCTTGAGATTTTATGTGAAGATGCTGAGGAGATGATTTTTCGAAT
CGAAGAGATAGAGATGACTCTGCGTATGGTAGAGCTTCCACTACTTTTTA
TGAAAAATACTTTTGAGAAAGCCTCTCTACAATACAACAGCTGCAAAGAG
ATGTTAGCCAAAGTAGAGCCCCAATGTAAGGAAAGCCCAACCTATAGAAG
TAGCCAAGAGCGCTTAGAAAGGTTGAATCAGGATTTACAAACAGCATATA
CAAATTGCCAGGAGAGACTCCAGGGTTTTTCAGATTTGGAATCAAAAGTA
CGTACATGTAGAGATCATCTTAGAGAGCAGATGAAACATTTCGAAGTTCA
AGGACTGAATTTTATAAACGAAGAGCTTTTATGGGTCGGGGCAGAGCTCT
TTACACAAGCCAGATTGGATCTAGTAGCAACAGTTCCGTATATGGAGTTC
TATTTGCAGTACCATAATATTAAAAGAGAAAAAGTTCGATCCCAATGGAT
GGCGAAGACCGAGAGGTATAGAGAGATTCGGCAGGCATTTCAAGGGGTGA
TGAAGGAAGATTTGTTAGCAGAAGATACGATCTTGAAAGAAGAAGATTAT
TGGCTGCTTCGCGATGATTGGTTGCTGCGTGATGAGAGGAAGAATAGACA
AAGACGTTTAATCTGTAATAAGATAGCAGCAGCGCAACAGCGAGTCAAAG
GCTTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy