Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR9 IGR7 IGR10 IGR4 IGR5 IGR8 IGR6 CPn0006 CPn0008 CPn0011 CPn0010 CPn0009 CPn0010.1 pmpG, - CPn0005 CPn0007 CPn0006 CPn0008 CPn0011 CPn0010 CPn0009 CPn0010.1 pmpG, - CPn0005 CPn0007 Type: direct, Name:  - 18 Type: tandem, Name:  - 1 Type: direct, Name:  - 19 Type: direct, Name:  - 16 Type: direct, Name:  - 13 Type: direct, Name:  - 16 Type: direct, Name:  - 14 Type: direct, Name:  - 14 CPn0006 CPn0008 CPn0011 CPn0010 CPn0009 CPn0010.1 pmpG, - CPn0005 CPn0007
* Calculated from Protein Sequence

Gene ID: CPn0008

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia pneumoniae-specific hypothetical protein

Gene Start:
10975

Gene Stop:
11688

Gene Length:
714

Molecular Weight*:
27817

pI*:
5.20

Net Charge*:
-5.72

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant hits in gapped BLAST outside of those sequences belonging to C. pneumoniae (see Paralogs report.)
BLAST reveals no significant similarity to C. trachomatis, M. genitalium, T. pallidum, or U. urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Numerous probable paralogs exist in C.pneumoniae: CPn0045, CPn1055, CPn0041, CPn0010, CPn1054, CPn0043, and CPn0007, all of which are predicted to be hypothetical proteins.

Pfam Summary:  Pfam Search
Residues 1 to 186 (E-value = 7.7e-84) place CPn0008 in the DUF256 family which is described as Protein of unknown function, DUF256 (PF03191)

PDB Hit:


Gene Protein Sequence:
VISGLLFLLVRREVPTVRSEEIPRGVSVTPSEEPALEKAQKEPETKKILD
RLPKELDQLDTYIQEVFACLERLKDPKYEDRGLLTEAKEKLRVFDVVEKD
MMSEFLDIQRVLNEEAYYVEHCQDPLENIAYEIFSSQELRDYYCAGVCGY
LPSGDARADRLKRSVKEVMDRFMRVTWKSWEASVMLDHSYGVARELFKKA
VGVLEESVYKILFKSYRDAFYECEKAKIQRDGRFKWL$

Gene Nucleotide Sequence:  Sequence Viewer
GTGATTTCGGGACTTCTATTCCTTCTAGTAAGACGAGAGGTTCCGACAGT
ACGTTCAGAGGAAATTCCCAGAGGGGTTTCTGTGACCCCTTCTGAAGAGC
CTGCTCTAGAGAAGGCTCAAAAAGAACCGGAGACAAAGAAAATTTTAGAT
CGGTTGCCGAAGGAATTGGATCAGTTAGATACGTATATTCAGGAAGTGTT
TGCATGTTTAGAGAGGCTGAAGGATCCTAAGTACGAAGATCGAGGTCTTT
TAACAGAGGCGAAGGAGAAACTTCGAGTTTTTGACGTTGTTGAGAAAGAT
ATGATGTCAGAGTTTTTAGACATACAACGAGTGTTGAATGAGGAAGCATA
TTATGTAGAACATTGTCAAGATCCCCTAGAGAATATAGCCTACGAGATTT
TCTCTTCCCAAGAGCTTCGTGATTACTACTGTGCAGGGGTGTGTGGGTAT
TTGCCTTCTGGGGATGCTCGAGCGGATCGATTAAAGAGATCAGTTAAGGA
GGTAATGGATCGCTTTATGAGGGTGACCTGGAAATCTTGGGAGGCATCAG
TCATGTTGGATCATAGCTATGGGGTAGCGCGAGAGTTATTCAAGAAGGCA
GTAGGAGTACTAGAGGAGAGTGTCTATAAAATTCTGTTTAAGAGCTATAG
AGATGCGTTTTATGAATGTGAGAAGGCAAAGATCCAGAGGGATGGGCGTT
TCAAATGGTTATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy