Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR7 IGR4 IGR3 IGR5 IGR8 IGR6 CPn0006 CPn0008 CPn0010 CPn0009 pmpG, - CPn0005 CPn0007 CPn0006 CPn0008 CPn0010 CPn0009 pmpG, - CPn0005 CPn0007 Type: tandem, Name:  - 1 Type: direct, Name:  - 16 Type: direct, Name:  - 13 Type: direct, Name:  - 14 Type: direct, Name:  - 16 Type: direct, Name:  - 19 Type: direct, Name:  - 14 CPn0006 CPn0008 CPn0010 CPn0009 pmpG, - CPn0005 CPn0007
* Calculated from Protein Sequence

Gene ID: CPn0007

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
7605

Gene Stop:
10499

Gene Length:
2895

Molecular Weight*:
108350

pI*:
6.20

Net Charge*:
-7.76

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Aside from hits to hypothetical sequences from C. pneumoniae (see Paralogs report), gapped BLAST revealed few hits to sequences outside of Chlamydia: residues 478-958 are 24% similar to liver stage antigen LSA-1 of Plasmodium falciparum; and residues 456-957 are 17% similar to golgi autoantigen, golgin subfamily A, 4 >1173565 (U31906) golgin-245 [Homo sapiens].
BLAST reveals no significant similarity to C. trachomatis, M. genitalium, T. pallidum, or U. urealyticum.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
Numerous possible paralogs found in C. pneumoniae, all of which are predicted to be hypothetical proteins:

CPn0126, CPn1054, CPn0043, CPn0045, CPn0012, CPn0124, CPn0041, CPn1055, CPn0009, and CPn0010.

Residues 242-955 are 25% similar to CPn0126.
Residues 216-956 are 26% similar to CPn1054.

Pfam Summary:  Pfam Search
Residues 236 to 458 (E-value = 3.6e-109) place CPn0007 in the DUF256 family which is described as Protein of unknown function, DUF256 (PF03191)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
12  
29
transmembrane  
41  
58
transmembrane  
120  
139
transmembrane  
151  
168
transmembrane  
230  
249
transmembrane  
263  
280
non-globular  
284  
440
coil-coil  
579  
611
coil-coil  
711  
738
coil-coil  
755  
782
coil-coil  
824  
876
coil-coil  
914  
964

PDB Hit:


Gene Protein Sequence:
MRKLRILAIVLIALSIILIAGGVVLLTVAIPGLSSVISSPAGMGACALGC
VMLALGIDVLLKKREVPIVLASVTTTPGTGSPRSGISISGADSTIRSLPT
YLLDEGHPQSMRKLRILAIVLIVFSIILIASGVVLLTVAIPGLSSVISSP
AGMGACALGCVMLALGIDVLLKKREVPIVLASVTTTPGTGSPRSGISISG
ADSTIRSLPTYPLDEGHPQSMRKLRILAIVLIVFSIILIASGVVLLTVAI
PGLSSIISSPAEMGACALGCVMLALGIDVLLKKREVPIVVPAPIPEEVVI
DDIDEESIRLQQEAEAALARLPEEMSAFEGYIKVVESHLENMKSLPYDGH
GLEEKTKHQIRVVRSSLKAMVPEFLDIRRIFEEEEFFFLSARKRLIDLAT
TLVERKILTEQLERNNLRKAFSYLYQDSIFKKIIDNFEKLAWKFMILSKS
ICRFTIIFENHEHGVAKSLLHKNAVLLEKVIYRSLQKSYRDIGMSSAKMK
ILHGNPFFSLEDNKKTIMKEHAEMLESLSSYRKVFLALSDENVVDTPSDP
KKWDLSGIPCRDALSEISRDEQWQKKAHLKHQESLYTQARDRLTDQSSKE
NQKELEKAEQEYISSWERVKKFEIERVQERIRAIQKLYPNILEREEETTG
QETVTPTVQGTTASSDLTDILGRIEVSSREDNQNQESCVKVLRSHEVEMS
WEVKQEYGPKKKEFQDQMGSLERFFTEHIEELEVLQKDYSKHLSYFKKVN
NKKEVQYAKFRLKVLESDLEGILAQTESAESLLTQEELPILATRGALEKA
VFKGSLCCALASKAKPYFEEDPRFQDSDTQLRALTLRLQEAKASLEEEIK
RFSNLENDIAEERRLLKESKQTFERAGLGVLREIAVESTYDLRSLTNTWE
GTPESEKVYFSMYLNYYNEEKRRAKTRLVEMTQRYRDFKMALEAMQFNEE
ALLQEELSIQAPSE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGGAAACTTCGTATTCTTGCGATCGTTCTCATAGCTTTGAGCATTAT
TTTGATTGCAGGTGGTGTGGTATTGCTTACTGTAGCGATCCCTGGATTAA
GTTCAGTCATTTCTTCCCCGGCAGGGATGGGTGCCTGTGCTTTGGGATGT
GTGATGCTTGCTTTAGGGATCGATGTTCTTCTGAAGAAACGAGAAGTCCC
TATAGTTCTCGCATCTGTAACTACGACACCAGGAACTGGCAGCCCTAGAA
GTGGTATTTCTATTTCAGGAGCTGATAGCACCATACGTTCTCTTCCTACG
TATCTCTTGGACGAGGGACATCCACAATCCATGAGGAAACTTCGTATTCT
TGCGATCGTTCTCATAGTTTTTAGCATTATTTTGATTGCAAGTGGTGTGG
TATTGCTTACTGTAGCGATCCCTGGATTAAGTTCAGTCATTTCTTCCCCG
GCAGGGATGGGTGCCTGTGCTTTGGGATGTGTGATGCTTGCTTTAGGGAT
CGATGTTCTTCTGAAGAAACGAGAAGTCCCTATAGTTCTCGCATCTGTAA
CTACGACACCAGGAACTGGCAGCCCTAGAAGTGGTATTTCTATTTCAGGA
GCTGATAGCACCATACGTTCTCTTCCTACGTATCCCTTGGACGAGGGACA
TCCACAATCCATGAGGAAACTTCGTATTCTTGCGATCGTTCTCATAGTTT
TTAGCATTATTTTGATTGCAAGTGGTGTGGTATTGCTTACTGTAGCGATC
CCTGGATTAAGCTCGATCATTTCTTCCCCAGCGGAGATGGGTGCTTGTGC
TTTGGGATGTGTGATGCTTGCTTTGGGGATCGACGTTCTTCTGAAGAAAC
GAGAAGTCCCTATAGTAGTTCCCGCACCTATTCCTGAAGAAGTCGTCATA
GATGATATAGATGAAGAGAGTATACGGCTGCAGCAGGAAGCTGAAGCCGC
TTTAGCAAGACTTCCTGAGGAGATGAGTGCATTTGAAGGTTACATAAAAG
TTGTCGAGAGTCATTTGGAGAACATGAAAAGCCTGCCTTATGATGGTCAT
GGGCTAGAAGAGAAAACGAAACATCAGATAAGAGTCGTCAGATCTTCTTT
GAAGGCTATGGTTCCAGAATTTTTAGATATCAGAAGAATTTTTGAAGAAG
AAGAGTTCTTTTTTCTCTCAGCTCGCAAACGACTTATAGATTTAGCTACT
ACTTTAGTAGAGAGAAAAATTTTAACAGAGCAACTTGAGCGCAATAATTT
AAGGAAAGCGTTTTCTTATTTATATCAGGACTCAATTTTTAAAAAAATTA
TTGATAACTTCGAGAAGTTAGCATGGAAATTTATGATTTTGAGTAAATCA
ATTTGTCGATTTACAATTATTTTTGAAAATCATGAACATGGTGTAGCAAA
GAGCCTGTTACACAAGAATGCAGTGTTACTGGAGAAGGTAATCTATAGGA
GTTTGCAAAAAAGCTATAGAGATATAGGCATGTCATCTGCAAAGATGAAA
ATCTTGCACGGCAACCCTTTTTTCTCTTTGGAAGATAATAAAAAGACGAT
AATGAAAGAACACGCAGAGATGCTTGAAAGTCTCAGTAGCTATAGGAAGG
TATTTTTAGCTCTATCTGATGAGAACGTTGTAGATACACCTAGCGATCCA
AAGAAATGGGATTTGTCAGGAATCCCCTGTAGGGACGCGTTGTCTGAGAT
TTCTCGTGATGAACAGTGGCAGAAGAAAGCACATCTAAAGCATCAAGAGT
CCCTCTATACGCAAGCTAGGGATCGTTTAACAGACCAGAGCTCTAAAGAA
AATCAGAAAGAGTTAGAGAAAGCTGAACAAGAGTACATATCTTCTTGGGA
ACGGGTTAAAAAATTTGAGATTGAGAGAGTACAGGAGAGGATACGGGCAA
TTCAAAAGCTTTATCCTAATATCCTCGAGAGAGAAGAAGAAACCACAGGT
CAGGAGACTGTGACTCCAACTGTTCAAGGGACGACGGCTTCATCCGATTT
AACAGATATTTTAGGAAGAATAGAGGTCTCCAGTAGGGAGGATAATCAGA
ATCAAGAGTCTTGTGTAAAAGTCTTAAGAAGTCATGAGGTAGAAATGAGC
TGGGAAGTCAAACAAGAGTATGGCCCTAAGAAAAAAGAATTTCAGGATCA
AATGGGTTCTTTAGAGAGGTTTTTTACAGAGCATATTGAAGAGTTAGAAG
TATTACAGAAGGACTACTCTAAACACTTGTCTTATTTTAAAAAAGTAAAC
AATAAGAAAGAGGTTCAATATGCGAAGTTTAGGTTGAAGGTTTTAGAGTC
AGATTTAGAAGGGATTCTAGCTCAGACTGAGAGTGCTGAGAGTCTGTTAA
CTCAAGAAGAACTTCCGATTCTTGCAACTCGGGGAGCCTTAGAGAAAGCT
GTTTTCAAAGGGAGTCTATGTTGCGCGCTAGCAAGCAAAGCAAAACCCTA
TTTTGAAGAGGATCCCAGATTCCAAGATTCTGATACGCAATTGCGAGCTC
TGACTCTAAGGTTACAGGAGGCTAAGGCAAGCCTGGAAGAAGAGATAAAG
AGATTTTCAAATCTTGAGAACGATATTGCAGAGGAAAGACGCCTTCTTAA
AGAGAGCAAGCAGACGTTCGAAAGAGCAGGTTTAGGGGTTCTCCGAGAAA
TTGCAGTCGAGTCTACTTATGATTTGCGTTCCTTAACAAATACATGGGAA
GGGACCCCAGAGAGTGAGAAGGTCTATTTTAGCATGTATCTTAATTATTA
CAACGAAGAGAAACGTAGGGCTAAAACAAGATTGGTTGAAATGACACAGA
GGTATAGAGATTTTAAAATGGCCTTGGAAGCTATGCAGTTTAATGAAGAA
GCCCTTTTGCAAGAGGAACTCTCTATTCAAGCTCCCAGTGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy