Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR7 IGR4 IGR3 IGR5 IGR6 CPn0006 CPn0008 CPn0009 gatA, - CPn0003 pmpG, - CPn0005 CPn0007 CPn0006 CPn0008 CPn0009 gatA, - CPn0003 pmpG, - CPn0005 CPn0007 Type: tandem, Name:  - 1 Type: direct, Name:  - 14 Type: direct, Name:  - 14 Type: direct, Name:  - 16 Type: direct, Name:  - 16 CPn0006 CPn0009 pmpG, - CPn0005 CPn0007 gatB, - CPn0004 gatB, - CPn0004 gatA, - CPn0003 CPn0008
* Calculated from Protein Sequence

Gene ID: CPn0006

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
hypothetical protein

Gene Start:
7293

Gene Stop:
7138

Gene Length:
156

Molecular Weight*:
5768

pI*:
5.00

Net Charge*:
-1.01

EC:
 

Functional Class:
unknown; hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
No significant similarity to any other known sequence.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs in C.pneumoniae.

Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:


Gene Protein Sequence:
LQEPLRSALLERLSEWLVLLGVPSPETTRSTPEKDANQLPKDSRNRTLES
L$

Gene Nucleotide Sequence:  Sequence Viewer
TTGCAGGAACCTCTTCGAAGCGCTCTCCTAGAGAGGCTATCAGAATGGCT
CGTCTTACTAGGAGTCCCAAGCCCTGAAACCACACGCTCTACTCCTGAGA
AAGACGCAAATCAGCTGCCAAAGGACTCAAGGAACAGAACCCTGGAATCC
CTATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy