Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap IGR2 IGR4 IGR3 IGR1 IGR5 IGR6 CPn0006 gatC, - CPn0002 gatA, - CPn0003 pmpG, - CPn0005 CPn0007 CPn0006 gatC, - CPn0002 gatA, - CPn0003 pmpG, - CPn0005 CPn0007 Type: tandem, Name:  - 1 Type: direct, Name:  - 14 Type: direct, Name:  - 14 Type: direct, Name:  - 16 Type: direct, Name:  - 16 CPn0006 gatC, - CPn0002 gatA, - CPn0003 pmpG, - CPn0005 CPn0007 gatB, - CPn0004 gatB, - CPn0004
* Calculated from Protein Sequence

Gene ID: CPn0005

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pmpG  

Definition:
outer membrane protein G

Gene Start:
4127

Gene Stop:
6895

Gene Length:
2769

Molecular Weight*:
100453

pI*:
6.80

Net Charge*:
-2.28

EC:
 

Functional Class:
cell envelope; membranes, lipoproteins and porins  

Pathway: pathway table

Comment:
Note that both CPn0005 and CPn0013 have best hits to CT871.

Blast Summary:  PSI-Blast Search
CPn0005 is similar to CT871, CT874, CT869, CT872, CT412, CT413, CT812,
CT414, and CT870. They are all predicted outer membrane proteins. CT871 is a predicted pmpG sequence: residues 31-922 are
27% similar to CT871.



COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
CPn0005 is paralogously related to 16 outer membrane proteins:CPn0446, CPn0447, CPn0445, CPn0451, CPn0453, CPn0444, CPn0013, CPn0540, CPn0963, CPn0467, CPn0466, CPn0471, CPn0539,CPn0454, CPn0452, CPn0470.

Pfam Summary:  Pfam Search
Residues 2 to 423 (E-value = 8.1e-206) place CPn0005 in the Chlam_PMP family which is described as Chlamydia polymorphic membrane protein (Chlamydia_PMP) (PF02415)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
26
non-globular  
433  
523

PDB Hit:


Gene Protein Sequence:
MRFSLCGFPLVFSFTLLSVFDTSLSATTISLTPEDSFHGDSQNAERSYNV
QAGDVYSLTGDVSISNVDNSALNKACFNVTSGSVTFAGNHHGLYFNNISS
GTTKEGAVLCCQDPQATARFSGFSTLSFIQSPGDIKEQGCLYSKNALMLL
NNYVVRFEQNQSKTKGGAISGANVTIVGNYDSVSFYQNAATFGGAIHSSG
PLQIAVNQAEIRFAQNTAKNGSGGALYSDGDIDIDQNAYVLFRENEALTT
AIGKGGAVCCLPTSGSSTPVPIVTFSDNKQLVFERNHSIMGGGAIYARKL
SISSGGPTLFINNISYANSQNLGGAIAIDTGGEISLSAEKGTITFQGNRT
SLPFLNGIHLLQNAKFLKLQARNGYSIEFYDPITSEADGSTQLNINGDPK
NKEYTGTILFSGEKSLANDPRDFKSTIPQNVNLSAGYLVIKEGAEVTVSK
FTQSPGSHLVLDLGTKLIASKEDIAITGLAIDIDSLSSSSTAAVIKANTA
NKQISVTDSIELISPTGNAYEDLRMRNSQTFPLLSLEPGAGGSVTVTAGD
FLPVSPHYGFQGNWKLAWTGTGNKVGEFFWDKINYKPRPEKEGNLVPNIL
WGNAVDVRSLMQVQETHASSLQTDRGLWIDGIGNFFHVSASEDNIRYRHN
SGGYVLSVNNEITPKHYTSMAFSQLFSRDKDYAVSNNEYRMYLGSYLYQY
TTSLGNIFRYASRNPNVNVGILSRRFLQNPLMIFHFLCAYGHATNDMKTD
YANFPMVKNSWRNNCWAIECGGSMPLLVFENGRLFQGAIPFMKLQLVYAY
QGDFKETTADGRRFSNGSLTSISVPLGIRFEKLALSQDVLYDFSFSYIPD
IFRKDPSCEAALVISGDSWLVPAAHVSRHAFVGSGTGRYHFNDYTELLCR
GSIECRPHARNYNINCGSKFRF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGATTTTCGCTCTGCGGATTTCCTCTAGTTTTTTCTTTTACATTGCT
CTCAGTCTTCGACACTTCTTTGAGTGCTACTACGATTTCTTTAACCCCAG
AAGATAGTTTTCATGGAGATAGTCAGAATGCAGAACGTTCTTATAATGTT
CAAGCTGGGGATGTCTATAGCCTTACTGGTGATGTCTCAATATCTAACGT
CGATAACTCTGCATTAAATAAAGCCTGCTTCAATGTGACCTCAGGAAGTG
TGACGTTCGCAGGAAATCATCATGGGTTATATTTTAATAATATTTCCTCA
GGAACTACAAAGGAAGGGGCTGTACTTTGTTGCCAAGATCCTCAAGCAAC
GGCACGTTTTTCTGGGTTCTCCACGCTCTCTTTTATTCAGAGCCCCGGAG
ATATTAAAGAACAGGGATGTCTCTATTCAAAAAATGCACTTATGCTCTTA
AACAATTATGTAGTGCGTTTTGAACAAAACCAAAGTAAGACTAAAGGCGG
AGCTATTAGTGGGGCGAATGTTACTATAGTAGGCAACTACGATTCCGTCT
CTTTCTATCAGAATGCAGCCACTTTTGGAGGTGCTATCCATTCTTCAGGT
CCCCTACAGATTGCAGTAAATCAGGCAGAGATAAGATTTGCACAAAATAC
TGCCAAGAATGGTTCTGGAGGGGCTTTGTACTCCGATGGTGATATTGATA
TTGATCAGAATGCTTATGTTCTATTTCGAGAAAATGAGGCATTGACTACT
GCTATAGGTAAGGGAGGGGCTGTCTGTTGTCTTCCCACTTCAGGAAGTAG
TACTCCAGTTCCTATTGTGACTTTCTCTGACAATAAACAGTTAGTCTTTG
AAAGAAACCATTCCATAATGGGTGGCGGAGCCATTTATGCTAGGAAACTT
AGCATCTCTTCAGGAGGTCCTACTCTATTTATCAATAATATATCATATGC
AAATTCGCAAAATTTAGGTGGAGCTATTGCCATTGATACTGGAGGGGAGA
TCAGTTTATCAGCAGAGAAAGGAACAATTACATTCCAAGGAAACCGGACG
AGCTTACCGTTTTTGAATGGCATCCATCTTTTACAAAATGCTAAATTCCT
GAAATTACAGGCGAGAAATGGATACTCTATAGAATTTTATGATCCTATTA
CTTCTGAAGCAGATGGGTCTACCCAATTGAATATCAACGGAGATCCTAAA
AATAAAGAGTACACAGGGACCATACTCTTTTCTGGAGAAAAGAGTCTAGC
AAACGATCCTAGGGATTTTAAATCTACAATCCCTCAGAACGTCAACCTGT
CTGCAGGATACTTAGTTATTAAAGAGGGGGCCGAAGTCACAGTTTCAAAA
TTCACGCAGTCTCCAGGATCGCATTTAGTTTTAGATTTAGGAACCAAACT
GATAGCCTCTAAGGAAGACATTGCCATCACAGGCCTCGCGATAGATATAG
ATAGCTTAAGCTCATCCTCAACAGCAGCTGTTATTAAAGCAAACACCGCA
AATAAACAGATATCCGTGACGGACTCTATAGAACTTATCTCGCCTACTGG
CAATGCCTATGAAGATCTCAGAATGAGAAATTCACAGACGTTCCCTCTGC
TCTCTTTAGAGCCTGGAGCCGGGGGTAGTGTGACTGTAACTGCTGGAGAT
TTCCTACCGGTAAGTCCCCATTATGGTTTTCAAGGCAATTGGAAATTAGC
TTGGACAGGAACTGGAAACAAAGTTGGAGAATTCTTCTGGGATAAAATAA
ATTATAAGCCTAGACCTGAAAAAGAAGGAAATTTAGTTCCTAATATCTTG
TGGGGGAATGCTGTAGATGTCAGATCCTTAATGCAGGTTCAAGAGACCCA
TGCATCGAGCTTACAGACAGATCGAGGGCTGTGGATCGATGGAATTGGGA
ATTTCTTCCATGTATCTGCCTCCGAAGACAATATAAGGTACCGTCATAAC
AGCGGTGGATATGTTCTATCTGTAAATAATGAGATCACACCTAAGCACTA
TACTTCGATGGCATTTTCCCAACTCTTTAGTAGAGACAAGGACTATGCGG
TTTCCAACAACGAATACAGAATGTATTTAGGATCGTATCTCTATCAATAT
ACAACCTCCCTAGGGAATATTTTCCGTTATGCTTCGCGTAACCCTAATGT
AAACGTCGGGATTCTCTCAAGAAGGTTTCTTCAAAATCCTCTTATGATTT
TTCATTTTTTGTGTGCTTATGGTCATGCCACCAATGATATGAAAACAGAC
TACGCAAATTTCCCTATGGTGAAAAACAGCTGGAGAAACAATTGTTGGGC
TATAGAGTGCGGAGGGAGCATGCCTCTATTGGTATTTGAGAACGGAAGAC
TTTTCCAAGGTGCCATCCCATTTATGAAACTACAATTAGTTTATGCTTAT
CAGGGAGATTTCAAAGAGACGACTGCAGATGGCCGTAGATTTAGTAATGG
GAGTTTAACATCGATTTCTGTACCTCTAGGCATACGCTTTGAGAAGCTGG
CACTTTCTCAGGATGTACTCTATGACTTTAGTTTCTCCTATATTCCTGAT
ATTTTCCGTAAGGATCCCTCATGTGAAGCTGCTCTGGTGATTAGCGGAGA
CTCCTGGCTTGTTCCGGCAGCACACGTATCAAGACATGCTTTTGTAGGGA
GTGGAACGGGTCGGTATCACTTTAACGACTATACTGAGCTCTTATGTCGA
GGAAGTATAGAATGCCGCCCCCATGCTAGGAATTATAATATAAACTGTGG
AAGCAAATTTCGTTTTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy