Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Ser_4 IGR2 IGR855 IGR4 IGR3 IGR1 IGR5 CPn0006 CPn0001 gatC, - CPn0002 CPn1073 CPn1072 gatA, - CPn0003 pmpG, - CPn0005 CPn0007 CPn0006 CPn0001 gatC, - CPn0002 CPn1073 CPn1072 gatA, - CPn0003 pmpG, - CPn0005 CPn0007 Type: tandem, Name:  - 1 Type: direct, Name:  - 14 Type: direct, Name:  - 16 Type: direct, Name:  - 16 CPn0006 gatC, - CPn0002 CPn1073 CPn1072 gatA, - CPn0003 pmpG, - CPn0005 CPn0007 gatB, - CPn0004 gatB, - CPn0004
* Calculated from Protein Sequence

Gene ID: CPn0004

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gatB  

Definition:
Glu-tRNA Gln amidotransferase subunit B

Gene Start:
2370

Gene Stop:
3836

Gene Length:
1467

Molecular Weight*:
54588

pI*:
5.00

Net Charge*:
-12.11

EC:
6.3.5.-  

Functional Class:
translation; tRNA aminoacylation  

Pathway: pathway table
Metabolism of macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
Disruption of this operon is lethal. This demonstrates that
transamidation is the only pathway to Gln-tRNA in B. subtilis and
that glutamyl-tRNA amidotransferase is a novel and essential
component of the translational apparatus.

Glu-tRNA Gln amidotransferase B subunit is required to maintain Rho+ mitochondrial DNA.
Plays some unknown role in the expression of mitochondrial genes generally, probably at
the level of translation.

See CPn0002 for subunit C (gatC) and CPn0003 for subunit A (gatA).

Blast Summary:  PSI-Blast Search
CPn0004 is orthologously related to CT004: residues 1-482 of CPn0004 are 75% similar to residues 1-482 of CT004, a predicted Glu-tRNA Gln amidotransferase subunit B from C. trachomatis.
CPn0004 is also similar to TP1021, UU544, MG100


COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 6 to 243 (E-value = 3e-143) place CPn0004 in the GatB_N family which is described as PET112 family, N terminal region (PF02934)
Residues 266 to 334 (E-value = 1.7e-38) place CPn0004 in the GatB family which is described as PET112 family, C terminal region (PF01162)
Residues 336 to 485 (E-value = 3.3e-68) place CPn0004 in the GatB_Yqey family which is described as GatB/Yqey domain (PF02637)

PDB Hit:


Gene Protein Sequence:
MSAVYADWESVIGLEVHVELNTASKLFSSALNRFGDEPNTNISTVCTGLP
GSLPVLNQSAVEKAVLFGCAVEGEISLLSRFDRKSYFYPDSPRNFQITQF
EHPIIRGGRIKAIVQGEERYFELAQTHIEDDAGMLKHFGEFAGVDYNRAG
VPLIEIVSKPCMFCPEDAVAYATSLVSLLDYIGISDCNMEEGSIRFDVNV
SVRPKGSPELRNKVEIKNMNSFAFMAQALEAEKQRQIDEYLNQPNKDPKL
VIPAATYRWDPEKKKTVLMRLKESAEDYKYFPEPDLPTLQLTESYIERIR
KTLPELPYDKYHRYIQEYGLSEDIASILISDKNIATFFEVACKDCKNFRS
LSNWVTVEFGGRCKTLGVKLPSSGIFPEGVAQLVNAIDQGVITGKIAKEI
ADLMMESPGKNPEEILKEKPELLPMSDEGELQKIIAEVVLANPESIVDYK
NGKTKALGFLVGQIMKRTAGKAPPKRVNELLLLELDKG$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTGCTGTTTATGCAGATTGGGAATCAGTCATAGGACTTGAAGTTCA
CGTAGAATTGAACACAGCATCCAAGTTATTTAGCTCTGCTTTAAATCGCT
TTGGAGATGAACCAAACACTAATATTTCTACAGTATGTACAGGATTGCCA
GGATCATTGCCTGTATTGAATCAGAGTGCCGTGGAGAAAGCTGTGCTTTT
TGGCTGCGCTGTCGAAGGTGAAATCTCTCTATTGAGTCGTTTCGATAGGA
AGTCTTACTTCTATCCCGATAGTCCCAGGAATTTTCAAATTACACAATTC
GAACATCCTATTATCCGAGGAGGACGCATTAAGGCGATTGTCCAAGGGGA
AGAGCGTTATTTTGAATTAGCCCAAACCCATATAGAAGATGATGCCGGAA
TGCTGAAGCACTTCGGAGAGTTTGCCGGTGTAGACTACAATCGTGCCGGA
GTCCCCCTAATCGAAATTGTTTCAAAACCCTGTATGTTTTGTCCTGAAGA
TGCTGTTGCTTACGCAACTTCTTTGGTTTCCTTGTTAGACTATATTGGAA
TTTCCGATTGCAATATGGAAGAAGGCTCCATCCGTTTTGATGTCAATGTC
TCCGTACGCCCTAAGGGATCCCCAGAACTTCGCAATAAGGTAGAAATCAA
GAATATGAACTCCTTCGCTTTTATGGCACAAGCTTTAGAAGCTGAAAAAC
AACGTCAGATCGATGAGTATCTTAATCAGCCAAATAAAGATCCCAAGCTG
GTGATTCCAGCCGCTACCTACCGCTGGGATCCCGAAAAGAAAAAAACTGT
GCTGATGCGTCTCAAAGAGAGTGCCGAAGATTATAAATATTTTCCCGAGC
CTGATCTGCCGACACTACAATTGACAGAGTCCTATATAGAAAGGATTCGC
AAGACCTTGCCAGAACTTCCTTATGACAAGTACCATCGCTATATTCAGGA
GTACGGTCTATCCGAAGATATCGCAAGTATTCTGATCAGCGATAAGAATA
TCGCAACGTTTTTTGAAGTCGCTTGTAAAGATTGTAAAAACTTTAGGTCT
TTATCTAACTGGGTAACCGTTGAATTTGGAGGCCGCTGCAAAACCCTAGG
AGTGAAGTTGCCATCTTCAGGAATTTTCCCCGAGGGAGTCGCTCAGCTGG
TCAACGCAATCGACCAAGGTGTGATCACAGGGAAAATTGCTAAGGAAATC
GCAGATCTTATGATGGAATCCCCAGGAAAGAATCCTGAGGAGATTTTAAA
AGAGAAGCCAGAGCTGCTTCCCATGTCAGATGAAGGGGAATTGCAGAAAA
TTATCGCAGAGGTGGTTCTTGCAAATCCTGAATCTATCGTAGACTATAAA
AATGGAAAGACTAAGGCTCTAGGATTCCTAGTCGGGCAGATTATGAAGCG
TACAGCAGGAAAAGCTCCTCCCAAGCGAGTGAACGAACTTTTACTTTTAG
AATTAGATAAGGGCTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy