Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Ser_4 IGR2 IGR855 IGR3 IGR1 IGR854 CPn0001 CPn1071 gatC, - CPn0002 CPn1073 CPn1072 gatA, - CPn0003 pmpG, - CPn0005 CPn0001 CPn1071 gatC, - CPn0002 CPn1073 CPn1072 gatA, - CPn0003 pmpG, - CPn0005 CPn1071 gatC, - CPn0002 CPn1073 CPn1072 gatA, - CPn0003 pmpG, - CPn0005 gatB, - CPn0004 gatB, - CPn0004
* Calculated from Protein Sequence

Gene ID: CPn0003

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gatA  

Definition:
Glu-tRNA Gln amidotransferase subunit A

Gene Start:
895

Gene Stop:
2373

Gene Length:
1479

Molecular Weight*:
53586

pI*:
6.80

Net Charge*:
-1.13

EC:
 

Functional Class:
translation; tRNA aminoacylation  

Pathway: pathway table

Comment:
For information on Glu-tRNA Gln amidotransferase, see "GENOMICS : REEVALUATION OF TRANSLATION MACHINERY EVOLUTION." 1998. KOONIN EV, ARAVIND L
CURRENT BIOLOGY 8(8): R266-R269.

Blast Summary:  PSI-Blast Search
CPn0003 is orthologously related to CT003: residues 1-480 are 71% similar residues 1-480 of CT003, a predicted Glu-tRNA-gln amidotransferase subunit A from C. trachomatis.
CPn0003 is also similar to TP1020, UU545, MG099.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 22 to 462 (E-value = 5.7e-197) place CPn0003 in the Amidase family which is described as Amidase (PF01425)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
145  
208

PDB Hit:


Gene Protein Sequence:
MYRYSALELAKAVTLGELTATGVTQHFFHRIEEAEGQVGAFISLCKEQAL
EQAELIDKKRSRGEPLGKLAGVPVGIKDNIHVTGLKTTCASRVLENYQPP
FDATVVERIKKEDGIILGKLNMDEFAMGSTTLYSAFHPTHNPWDLSRVPG
GSSGGSAAAVSARFCPVALGSDTGGSIRQPAAFCGVVGFKPSYGAVSRYG
LVAFASSLDQIGPLANTVEDVALMMDVFSGRDPKDATSREFFRDSFMSKL
STEVPKVIGVPRTFLEGLRDDIRENFFSSLAIFEGEGTHLVDVELDILSH
AVSIYYILASAEAATNLARFDGVRYGYRSPQAHTISQLYDLSRGEGFGKE
VMRRILLGNYVLSAERQNVYYKKATAVRAKIVKAFRTAFEKCEILAMPVC
SSPAFEIGEILDPVTLYLQDIYTVAMNLAYLPAIAVPSGFSKEGLPLGLQ
IIGQQGQDQQVCQVGYSFQEHAQIKQLFSKRYAKSVVLGGQS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTATCGATATAGTGCTTTAGAATTAGCAAAAGCTGTGACTTTAGGGGA
ACTGACAGCCACAGGGGTGACTCAACATTTTTTTCATAGAATAGAAGAAG
CTGAGGGGCAGGTAGGTGCCTTTATTTCCTTGTGTAAGGAACAAGCTTTA
GAACAGGCAGAGCTCATAGATAAAAAGCGTTCGCGTGGAGAACCTTTAGG
AAAACTCGCAGGTGTTCCTGTAGGAATTAAAGATAATATTCACGTTACAG
GCCTGAAGACAACATGCGCCTCTCGTGTGCTCGAGAATTATCAACCACCG
TTTGATGCTACTGTTGTAGAAAGAATCAAAAAAGAAGATGGGATTATCTT
AGGCAAACTCAATATGGATGAGTTTGCTATGGGATCAACAACGCTATATT
CTGCTTTTCATCCTACCCACAACCCCTGGGATTTATCTCGTGTTCCTGGA
GGTTCTTCAGGGGGATCTGCGGCCGCAGTTTCTGCTAGATTTTGTCCCGT
AGCCCTAGGATCAGATACCGGAGGATCCATCCGTCAGCCCGCAGCATTTT
GTGGTGTTGTAGGTTTTAAGCCTTCCTACGGAGCCGTTTCGCGTTACGGG
CTTGTAGCCTTTGCCTCTTCGCTAGATCAAATCGGTCCTTTAGCCAATAC
TGTAGAAGACGTCGCCCTAATGATGGATGTGTTTTCTGGTAGAGATCCTA
AAGATGCAACCTCAAGAGAGTTTTTCCGTGATTCTTTTATGAGCAAGTTG
TCTACGGAGGTTCCTAAAGTGATTGGGGTGCCTAGAACATTTTTAGAGGG
ACTCCGTGATGATATTAGGGAGAATTTCTTCTCTTCATTAGCCATTTTTG
AAGGAGAAGGAACCCATCTTGTGGATGTGGAGTTGGATATTCTCAGCCAC
GCTGTATCTATATATTACATTTTAGCATCTGCTGAAGCTGCCACGAATTT
AGCAAGGTTCGATGGGGTGCGTTATGGATATCGTTCTCCTCAAGCGCATA
CCATCAGCCAACTCTACGATCTCTCACGTGGAGAAGGATTTGGCAAAGAG
GTCATGCGCAGAATCCTCTTAGGGAACTATGTCTTGTCTGCGGAGAGACA
GAATGTTTATTATAAGAAAGCTACGGCAGTGCGTGCTAAGATTGTAAAAG
CATTTAGAACTGCATTTGAAAAGTGTGAAATCTTAGCCATGCCCGTCTGT
TCTAGCCCCGCGTTTGAAATAGGAGAAATTCTAGATCCTGTGACTTTATA
TCTACAGGATATCTATACTGTAGCTATGAATTTAGCGTATCTTCCTGCCA
TTGCCGTACCCTCTGGATTTTCTAAGGAGGGCCTGCCCTTAGGCCTACAG
ATTATCGGACAGCAAGGACAAGACCAACAAGTGTGCCAAGTGGGTTACAG
TTTCCAAGAGCATGCGCAAATTAAGCAATTGTTTTCTAAGAGATATGCCA
AAAGTGTTGTTCTAGGAGGTCAATCATGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy