Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Ser_4 IGR2 IGR855 IGR3 IGR1 IGR854 CPn0001 CPn1071 gatC, - CPn0002 CPn1073 CPn1072 gatA, - CPn0003 pmpG, - CPn0005 CPn0001 CPn1071 gatC, - CPn0002 CPn1073 CPn1072 gatA, - CPn0003 pmpG, - CPn0005 CPn1071 gatC, - CPn0002 CPn1073 CPn1072 gatA, - CPn0003 pmpG, - CPn0005 gatB, - CPn0004 gatB, - CPn0004
* Calculated from Protein Sequence

Gene ID: CPn0002

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
gatC  

Definition:
Glu-tRNA Gln amidotransferase subunit C

Gene Start:
573

Gene Stop:
878

Gene Length:
306

Molecular Weight*:
11336

pI*:
4.10

Net Charge*:
-12.56

EC:
6.3.5.-  

Functional Class:
translation; tRNA aminoacylation  

Pathway: pathway table
Metabolism of macromolecules; Aminoacyl-tRNA biosynthesis

Comment:
This sequence is identical to GenBank accession AAD18160 (genome section accession AE001585). Possible Glu-tRNAGln amidotransferase.

Blast Summary:  PSI-Blast Search
CPn0002 is orthologously related to CT002: residues 1-101 of CPn0002 are 53% similar to residues 1-100 of CT002, a predicted Glu-tRNA Gln amidotransferase C subunit from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search


ProDom Summary:  Protein Domain Search


Paralogs:  Local Blast Search
No paralogs in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 22 to 96 (E-value = 1.4e-29) place CPn0002 in the Glu-tRNAGln family which is described as Glu-tRNAGln amidotransferase C subunit (PF02686)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
16  
47

PDB Hit:


Gene Protein Sequence:
MEQFHLDREEILLLAKASALQLSEELIQEYQTSLSAVITSMKEALAIEID
DADSCESLFMHVVNVEDLREDSVTSDFNREEFLRNVPESLGGLVKVPAVI
K$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAGCAATTTCATTTGGATAGGGAAGAAATTTTACTTTTGGCAAAGGC
CTCAGCACTACAACTTTCTGAAGAGCTTATCCAGGAGTATCAAACTTCTT
TAAGCGCTGTGATTACTTCTATGAAAGAAGCTCTTGCCATAGAGATTGAT
GATGCGGATTCATGCGAATCTCTTTTTATGCATGTAGTAAATGTTGAAGA
TTTGAGAGAAGATTCGGTGACCTCTGATTTCAATCGAGAGGAATTTTTGC
GTAATGTTCCAGAGTCTTTAGGGGGATTAGTGAAAGTTCCTGCGGTAATC
AAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy