Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia pneumoniae Search Results

Record: 1 of 1  
MiniMap tRNA_Ser_4 IGR2 IGR855 IGR3 IGR1 IGR853 IGR854 CPn0001 CPn1070 CPn1071 gatC, - CPn0002 CPn1073 CPn1072 gatA, - CPn0003 pmpG, - CPn0005 CPn0001 CPn1070 CPn1071 gatC, - CPn0002 CPn1073 CPn1072 gatA, - CPn0003 pmpG, - CPn0005 CPn1070 CPn1071 gatC, - CPn0002 CPn1073 CPn1072 gatA, - CPn0003 pmpG, - CPn0005 gatB, - CPn0004 gatB, - CPn0004
* Calculated from Protein Sequence

Gene ID: CPn0001

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
Chlamydia-specific hypothetical protein

Gene Start:
282

Gene Stop:
1

Gene Length:
282

Molecular Weight*:
9698

pI*:
8.80

Net Charge*:
7.08

EC:
 

Functional Class:
unknown; Chlamydia-specific proteins  

Pathway: pathway table

Comment:
This sequence is identical to GenBank accession AAD18159.

Blast Summary:  PSI-Blast Search
CPn0001 is orthologously related to CT001: residues 1-92 of CPn0001 are 50% similar to residues 1-89 of CT001, a predicted Chlamydia-specific hypothetical protein from C. trachomatis.

COGS Summary:  COGS Search
No hit to the COGs database.

Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
None.

Paralogs:  Local Blast Search
No paralogs found in C. pneumoniae.

Pfam Summary:  Pfam Search
Residues 2 to 80 (E-value = 4.6e-50) place CPn0001 in the DUF378 family which is described as Domain of unknown function (DUF378) (PF04070)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
11  
28
transmembrane  
45  
63

PDB Hit:


Gene Protein Sequence:
MLGKIIRGLSSLIVILCALNVGLIGITHNKLNIIAKLCGGVSTPATQITY
IIIGIAGVICLLSFCPFCSKKSRHSHGDSCSSGGCHSHHSDKN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTAGGCAAAATTATTCGAGGATTATCCTCTCTTATTGTTATTCTTTG
TGCATTGAACGTGGGACTTATAGGAATCACTCACAATAAATTAAATATTA
TTGCTAAGTTGTGTGGAGGCGTTTCTACTCCTGCCACCCAAATTACCTAT
ATTATCATTGGAATTGCTGGTGTCATTTGCTTGCTAAGCTTTTGTCCTTT
CTGCAGCAAGAAGTCCCGTCATTCACACGGAGACAGCTGCTCTTCAGGAG
GCTGCCACTCTCATCATTCTGACAAAAATTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy