Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  NOTE: This map has been re-scaled because the DNA molecule is smaller than the standard map area.

MiniMap pIGR5 pIGR1.1 pIGR2 pIGR3 pIGR1 pIGR4 pCT08 pCT04 minD, - pCT05 pCT06 pCT03 pCT07 dnaB, - pCT01 pCT08 pCT04 minD, - pCT05 pCT06 pCT03 pCT07 dnaB, - pCT01 pCT08 pCT04 minD, - pCT05 pCT06 pCT03 pCT07 dnaB, - pCT01 pCT02 pCT02
* Calculated from Protein Sequence

Gene ID: pCT01

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dnaB  

Definition:
plasmid factor PGP1-D: DNA helicase

Gene Start:
99

Gene Stop:
1451

Gene Length:
451

Molecular Weight*:
51387

pI*:
9.15

Net Charge*:
7.49

EC:
3.6.1.-  

Functional Class:
DNA replication and repair  

Pathway: pathway table

Primary Evidence:
Ricci S, Ratti G, Scarlato V. 1995. Transcriptional regulation in the Chlamydia trachomatis pCT plasmid. Gene 154(1):93-8. Medline: 7532607.

Comanducci M, Ricci S, Cevenini R, Ratti G. 1990. Diversity of the Chlamydia trachomatis common plasmid in biovars with different pathogenicity. Plasmid 23(2):149-54. Medline: 2194229.

Hatt C, Ward ME, Clarke IN. 1988. Analysis of the entire nucleotide sequence of the cryptic plasmid of Chlamydia trachomatis serovar L1. Evidence for involvement in DNA replication. Nucleic Acids Res 16(9):4053-67. Medline: 2836808.

Comanducci M, Ricci S, Ratti G. 1988. The structure of a plasmid of Chlamydia trachomatis believed to be required for growth within mammalian cells. Mol Microbiol 2(4):531-8. Medline: 2845228.

Secondary Evidence:
Kaplan,D.L. and Steitz,T.A. 1999. DnaB from Thermus aquaticus unwinds forked duplex DNA with an asymmetric tail length dependence. J. Biol. Chem. 274(11): 6889-6897. Medline: 10066742.

Sakamoto,Y., Nakai,S., Moriya,S., Yoshikawa,H. and Ogasawara,N. 1995. The Bacillus subtilis dnaC gene encodes a protein homologous to the DnaB helicase of Escherichia coli. Microbiology 141(Pt 3): 641-644. Medline: 95227361.

Nakayama,N., Arai,N., Bond,M.W., Kaziro,Y. and Arai,K. 1984. Nucleotide sequence of dnaB and the primary structure of the dnaB protein from Escherichia coli. J. Biol. Chem. 259(1): 97-101. Medline: 84161990.

Comment:
In E.coli, the DnaB protein is involved in initiation and elongation during chromosome replication. It is a homomeric enzyme.

Blast Summary:  PSI-Blast Search
Equal to the previously sequenced DNB2_CHLTR. See also DNB1_CHLTR.
pCT01 is 28% similar over residues 30-461 to TP0058 in T.pallidum, a predicted dnaB protein.
It is also similar to MG094, a DNA helicase in M.genitalium. This protein is similar to PG1098, a predicted replicative DNA helicase from Porphyromonas gingivalis.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0305
COG name: Replicative DNA helicase
Functional Class:  L
The phylogenetic pattern of COG0305 is -----qvCeBRhujgpOlinx
Number of proteins in this genome belonging to this COG is 2


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 18-466 span eight DNA helicase domains as seen in
GP1D_CHLTR, DNAB_CHLTR, PRIM_BPT7, VG41_BPT4, VG65_BPML5,
DNAB_MYCGE.

Paralogs:  Local Blast Search
pCT01 is paralogously related to CT497, a predicted DNA helicase:
residues 188-461 are 38% similar to CT497.

Pfam Summary:  Pfam Search
Residues 7 to 109 (E-value = 2.3e-21) place pCT01 in the DnaB family which is described as DnaB-like helicase N terminal domain (PF00772)
Residues 197 to 393 (E-value = 8.2e-106) place pCT01 in the DnaB_C family which is described as DnaB-like helicase C terminal domain (PF03796)

PDB Hit:
None.

Gene Protein Sequence:
MKTRSEIENRMQDIEYALLGKALIFEDSTEYILRQLANYEFKCSHHKNIF
IVFKYLKDNGLPITVDSAWEELLRRRIKDMDKSYLGLMLHDALSNDKLRS
VSHTVFLDDLSVCSAEENLSNFIFRSFNEYNENPLRRSPFLLLERIKGRL
DSAIAKTFSIRSARGRSIYDIFSQSEIGVLARIKKRRAAFSENQNSFFDG
FPTGYKDIDDKGVILAKGNFVIIAARPSIGKTALAIDMAINLAVTQQRRV
GFLSLEMSAGQIVERIVANLTGISGEKLQRGDLSKEELFRVEEAGETVRE
SHFYICSDSQYKLNLIANQIRLLRKEDRVDVIFIDYLQLINSSVGENRQN
EIADISRTLRGLASELNIPIVCLSQLSRKVEDRANKVPMLSDLRDSGQIE
QDADVILFINRKESSSNCEITVGKNRHGSVFSSVLHFDPKISKFSAIKKV
W

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAACTCGTTCCGAAATAGAAAATCGCATGCAAGATATCGAGTATGC
GTTGTTAGGTAAAGCTCTGATATTTGAAGACTCTACTGAGTATATTCTGA
GGCAGCTTGCTAATTATGAGTTTAAGTGTTCCCATCATAAAAACATATTC
ATAGTATTTAAATACTTAAAAGACAATGGATTACCTATAACTGTAGACTC
GGCTTGGGAAGAGCTTTTGCGGCGTCGTATCAAAGATATGGACAAATCGT
ATCTCGGGTTAATGTTGCATGATGCTTTATCAAATGACAAGCTTAGATCC
GTTTCTCATACGGTTTTCCTCGATGATTTGAGCGTGTGTAGCGCTGAAGA
AAATTTGAGCAATTTCATTTTCCGCTCGTTTAATGAGTACAATGAAAATC
CATTGCGTAGATCTCCGTTTCTATTGCTTGAGCGTATAAAGGGAAGGCTT
GATAGTGCTATAGCAAAGACTTTTTCTATTCGCAGCGCTAGAGGCCGGTC
TATTTATGATATATTCTCACAGTCAGAAATTGGAGTGCTGGCTCGTATAA
AAAAAAGACGAGCAGCGTTCTCTGAGAATCAAAATTCTTTCTTTGATGGC
TTCCCAACAGGATACAAGGATATTGATGATAAAGGAGTTATCTTAGCTAA
AGGTAATTTCGTGATTATAGCAGCTAGGCCATCTATAGGGAAAACAGCTT
TAGCTATAGACATGGCGATAAATCTTGCGGTTACTCAACAGCGTAGAGTT
GGTTTCCTATCTCTAGAAATGAGCGCAGGTCAAATTGTTGAGCGGATTGT
TGCTAATTTAACAGGAATATCTGGTGAAAAATTACAAAGAGGGGATCTCT
CTAAAGAAGAATTATTCCGAGTGGAAGAAGCTGGAGAAACAGTTAGAGAA
TCACATTTTTATATCTGCAGTGATAGTCAGTATAAGCTTAATTTAATCGC
GAATCAGATCCGGTTGCTGAGAAAAGAAGATCGAGTAGACGTAATATTTA
TCGATTACTTGCAGTTGATCAACTCATCGGTTGGAGAAAATCGTCAAAAT
GAAATAGCAGATATATCTAGAACCTTAAGAGGTTTAGCCTCAGAGCTAAA
CATTCCTATAGTTTGTTTATCCCAACTATCTAGAAAAGTTGAGGATAGAG
CAAATAAAGTTCCCATGCTTTCAGATTTGCGAGACAGCGGTCAAATAGAG
CAAGACGCAGATGTGATTTTGTTTATCAATAGGAAGGAATCGTCTTCTAA
TTGTGAGATAACTGTTGGGAAAAATAGACATGGATCGGTTTTCTCTTCGG
TATTACATTTCGATCCAAAAATTAGTAAATTCTCCGCTATTAAAAAAGTA
TGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy