Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Leu-5 IGR724 IGR723 IGR726 IGR725 IGR722 IGR721 xerD, - CT864 CT867 CT868 CT863 pmpE, - CT869 CT865 glgB, - CT866 xerD, - CT864 CT867 CT868 CT863 pmpE, - CT869 CT865 glgB, - CT866 xerD, - CT864 CT867 CT868 CT863 pmpE, - CT869 CT865 glgB, - CT866
* Calculated from Protein Sequence

Gene ID: CT866

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
glgB  

Definition:
1,4-alpha-glucan branching enzyme

Gene Start:
1020758

Gene Stop:
1022971

Gene Length:
2214

Molecular Weight*:
84612

pI*:
5.13

Net Charge*:
-32.41

EC:
2.4.1.18  

Functional Class:
energy metabolism; starch and sucrose metabolism  

Pathway: pathway table
Metabolism of Complex Carbohydrates; Starch and sucrose metabolism

Secondary Evidence:
Larsson,C.T., Khoshnoodi,J., Ek,B., Rask,L. and Larsson,H. 1998.
Molecular cloning and characterization of starch-branching enzyme II from potato. Plant Mol. Biol. 37(3): 505-511. Medline: 98278379.

Mizuno,K., Kawasaki,T., Shimada,H., Satoh,H., Kobayashi,E.,
Okumura,S., Arai,Y. and Baba,T. 1993. Alteration of the structural
properties of starch components by the lack of an isoform of starch branching enzyme in rice seeds. J. Biol. Chem. 268(25): 19084-19091. Medline: 93366833.

Thon,V.J., Khalil,M. and Cannon,J.F. 1993. Isolation of human glycogen branching enzyme cDNAs by screening complementation in yeast. J. Biol. Chem. 268:(10): 7509-7513. Medline: 93216700.

Comment:
See CT042.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to 1,4-alpha-glucan branching enzyme sequences, e.g. residues 6-686 are 45% similar to GLGB_SYNP7.

CT866 is orthologously related to CPn0475, a predicted glucan branching enzyme: residues 11-736 are 63% similar to CPn0475. This protein is similar to PG1568, a predicted starch branching enzyme from Porphyromonas gingivalis. No similarity to T. pallidum or M. genitalium.

COGS Summary:  COGS Search
BeTs to 7 clades of COG0296
COG name: 1,4-alpha-glucan branching enzyme
Functional Class:  G
The phylogenetic pattern of COG0296 is ----yq-cebRh------in-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 606-623, 51-68 are matched to block PR00692B,
concerned with T-cell surface glycoprotein CD4 signature, represented by CD4_CERAE.
Residues 323-334, 393-404 are matched to blocks PR00110B,C
concerned with Alpha-amylase signature sequences
represented by AATRAMY.
Residues 188-207, 287-314 are matched to blocks PR00193A,C,
concerned with myosin heavy chain sequences represented by MYSN_ACACA.

ProDom Summary:  Protein Domain Search
Residues 406-686 are 48% similar to a 1,4-alpha-glucan
branching enzyme domain represented by GLGB_SYNP7.
Residues 107-130, 137-201, 208-250, 269-387 support this assignment, e.g.GLGB_SYNY3.

Paralogs:  Local Blast Search
CT866 is paralogously related to CT042: residues 134-402 re 22% similar to CT042, a predicted glycogen debranching protein.

Pfam Summary:  Pfam Search
Residues 119 to 202 (E-value = 2.6e-33) place CT866 in the Isoamylase_N family which is described as Isoamylase N-terminal domain (PF02922)
Residues 243 to 592 (E-value = 8.5e-07) place CT866 in the Alpha-amylase family which is described as Alpha amylase, catalytic domain (PF00128)

PDB Hit:
gi|999671|pdb|1CYG| Cyclodextrin Glucanotransferase (E.C.2.4.1.19) (Cgtase)

Gene Protein Sequence:
MDPFFLNTQHVELLVSGKQSSPQDLLGIVSESLNQDRIVLFRPGAETVFV
ELRGKIQQAESHHSGIFSLPVMKGISPQDYRVYHQNGLLAHDPYAFPLLW
GEIDSFLFHEGTHQRIYERMGAIPCEIDGVPGVRFIVWAPHAQRVSVIGD
FNGWHGLVNPLHKVSDQGVWELFVPGLTAGACYKWEMVTESGQVLIKSDP
YGKFFGPPPWSVSVVIDDSYEWTDSEWLEERIKKTEGPMNIYEVHVGSWR
WQEGQPLNYKELADQLALYCKQMHYTHVELLPVTEHPLNESWGYQTTGYY
APTSRYGSFEDLQYFIDTMHQHGIGVILDWVPGHFPIDSFAMSGFDGTPL
YEYTRNPSPLHPHWHTYTFDYAKPEVCNFLLGSVLFWIDKMHVDGIRVDA
VSSMLYLDYGRYAGEWVPNRYGGRENLDAIRFLQQFNTVIHEKYPGVLTF
AEESTTFPKITVSVEEGGLGFDYKWNMGWMHDTLHYFEKDFPYRPYHQSD
LTFPQWYAFSERFLLPFSHDEVVHGKRSLIGKMPGDAWRQFAQLRLLLGY
QICQPGKKLLFMGGEFGQGREWSPGRELDWELLDISYHQGVHLCSQELNA
LYVQSPQLWQADHLPSSFRWVDFSDVRNGVVAYLRFADADAKKALLCVHH
FGVGYFPHYLLPILPLESCDLLMNTDDTRFGGSGKGFREPEILTPEIARQ
EREAAGLIEADDESGPDCWGLDIELPPSATLIFSVTLQ

Gene Nucleotide Sequence:  Sequence Viewer
GTGGATCCTTTTTTCTTAAATACTCAACACGTGGAACTTCTCGTTTCTGG
TAAACAGAGCAGTCCACAAGATCTTTTGGGAATTGTTTCTGAAAGTTTGA
ATCAAGATCGGATAGTTCTTTTCCGCCCTGGGGCAGAGACCGTTTTTGTT
GAGTTGCGAGGTAAGATTCAACAGGCAGAGTCGCACCATTCAGGGATTTT
TTCTCTTCCTGTAATGAAAGGAATTTCTCCCCAAGATTATCGAGTCTATC
ATCAAAATGGTTTATTGGCTCATGATCCTTATGCCTTCCCTTTACTTTGG
GGGGAAATCGATTCTTTTTTATTCCATGAAGGGACTCATCAGCGTATCTA
TGAACGCATGGGTGCTATCCCTTGTGAAATTGATGGAGTACCTGGAGTAA
GATTTATTGTTTGGGCCCCTCATGCTCAACGTGTTTCTGTTATTGGAGAT
TTTAATGGGTGGCATGGGCTCGTTAATCCTCTTCATAAGGTTTCAGATCA
AGGAGTTTGGGAGCTGTTTGTTCCTGGCCTTACAGCAGGAGCTTGTTACA
AATGGGAAATGGTCACAGAATCTGGGCAGGTTCTCATTAAATCGGATCCT
TATGGGAAGTTTTTTGGTCCTCCTCCTTGGAGCGTTTCCGTTGTTATCGA
TGATTCTTATGAATGGACCGATAGCGAGTGGTTAGAAGAGCGCATTAAAA
AGACTGAAGGCCCTATGAACATCTATGAAGTTCATGTAGGGTCTTGGCGA
TGGCAGGAAGGACAACCTTTGAATTATAAAGAGCTAGCAGATCAGCTAGC
TCTCTATTGCAAGCAGATGCATTATACGCATGTAGAGTTGCTTCCCGTAA
CCGAGCATCCTTTGAATGAATCTTGGGGATATCAAACAACGGGATATTAT
GCTCCTACAAGTCGTTATGGCTCTTTTGAAGATTTACAGTATTTTATAGA
TACCATGCATCAGCATGGTATCGGGGTGATTTTAGATTGGGTTCCAGGAC
ACTTCCCTATAGATTCATTTGCAATGAGTGGTTTTGATGGCACTCCTCTG
TATGAATATACACGGAATCCGAGTCCGTTGCATCCTCACTGGCACACCTA
CACTTTTGATTATGCTAAACCGGAAGTGTGCAATTTTCTTTTAGGAAGTG
TGCTCTTTTGGATCGATAAAATGCATGTAGATGGTATTCGTGTGGATGCT
GTCTCATCTATGCTCTATTTAGATTATGGAAGATATGCTGGAGAATGGGT
TCCAAATCGTTATGGTGGAAGAGAGAACCTTGATGCGATTCGGTTTCTTC
AGCAATTCAACACTGTGATTCATGAGAAATATCCAGGTGTTTTGACTTTC
GCAGAGGAGTCGACAACCTTCCCTAAGATTACTGTATCTGTCGAAGAAGG
GGGATTAGGGTTTGATTACAAATGGAATATGGGATGGATGCATGATACAC
TGCATTATTTCGAGAAGGATTTCCCATATCGTCCTTATCACCAGAGCGAT
CTCACTTTCCCACAATGGTATGCTTTTAGTGAGAGGTTTTTACTGCCTTT
TTCCCATGATGAGGTTGTTCATGGGAAACGCAGTTTAATCGGTAAGATGC
CTGGAGATGCTTGGAGACAGTTTGCTCAGTTGCGTTTATTATTAGGTTAT
CAGATCTGTCAACCAGGAAAGAAATTGCTTTTCATGGGGGGAGAGTTCGG
TCAGGGGAGAGAGTGGTCCCCCGGTCGTGAGCTAGACTGGGAATTATTAG
ATATTTCTTATCATCAAGGTGTGCATTTGTGTTCGCAAGAGCTAAATGCT
TTATATGTGCAGAGCCCGCAACTGTGGCAAGCGGACCATCTTCCCTCCTC
TTTCCGTTGGGTTGATTTTAGTGATGTGCGTAATGGCGTTGTTGCTTATC
TCCGCTTTGCAGACGCGGATGCTAAGAAAGCTTTGCTTTGCGTGCATCAT
TTTGGGGTAGGATACTTTCCTCATTACTTACTTCCCATACTCCCCCTAGA
ATCTTGTGATTTGCTGATGAATACAGATGACACAAGATTCGGGGGATCGG
GGAAAGGTTTTCGAGAGCCTGAAATCCTTACACCTGAAATCGCGAGACAA
GAGAGAGAGGCTGCAGGACTGATCGAAGCGGATGATGAAAGTGGTCCCGA
CTGCTGGGGCTTAGATATTGAGTTGCCTCCTTCAGCTACTCTGATTTTCT
CTGTAACGCTACAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy