Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR711 IGR713 IGR710 IGR714 IGR716 IGR712 IGR715 CT853 CT852 map, - CT851 ychM, - CT856 CT854 CT850 nhaD, - CT857 fumC, - CT855 CT858 CT853 CT852 map, - CT851 ychM, - CT856 CT854 CT850 nhaD, - CT857 fumC, - CT855 CT858 CT853 CT852 map, - CT851 ychM, - CT856 CT854 CT850 nhaD, - CT857 fumC, - CT855 CT858
* Calculated from Protein Sequence

Gene ID: CT855

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
fumC  

Definition:
fumarate hydratase class II

Gene Start:
1004550

Gene Stop:
1005938

Gene Length:
1389

Molecular Weight*:
50328

pI*:
6.51

Net Charge*:
-4.60

EC:
4.2.1.2  

Functional Class:
central intermediary metabolism; TCA cycle  

Pathway: pathway table
Carbohydrate Metabolism; Citrate cycle (TCA cycle)

Secondary Evidence:
Woods,S.A., Miles,J.S., Roberts,R.E. and Guest,J.R. 1986. Structural and functional relationships between fumarase and aspartase. Nucleotide sequences of the fumarase (fumC) and aspartase (aspA) genes of Escherichia coli K12. Biochem. J. 237(2): 547-557. Medline: 87099873.

Takagi,J.S., Tokushige,M. and Shimura,Y. 1986. Cloning and nucleotide sequence of the aspartase gene of Pseudomonas fluorescens. J. Biochem. 100(3): 697-705. Medline: 87057132.

Takagi,J.S., Ida,N., Tokushige,M., Sakamoto,H. and Shimura,Y. 1985. Cloning and nucleotide sequence of the aspartase gene of Escherichia coli W. Nucleic Acids Res. 13(6): 2063-2074. Medline: 85215599.

Comment:
Fumarate hydratase catalyzes the reversible hydration of fumarate to L-malate. There seem to be 2 classes of fumarases: class I are thermolabile dimeric enzymes and class II enzymes are thermostable tetramers found in prokaryotes as well as in eukaryotes.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to fumarate hydratase class II protein sequences, e.g. residues 2-457 are 55% similar to D64000.

CT855 is orthologously related to CPn1013: residues 1-459 are 78% similar to that of CPn1013. This protein is also similar to PG1518, a predicted aspartate ammonia-lyase from Porphyromonas gingivalis. No similarites to T. pallidum or M. genitalium.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0114
COG name: Fumarase
Functional Class: C
The phylogenetic pattern of COG0114 is ----y--cebrhuj----inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 6-23, 182-196, 314-324 are matched to blocks BL00163A,B,C,
concerned with Fumarate lyases proteins, represented by FUMC_ECOLI.

ProDom Summary:  Protein Domain Search
Residues 229-453 are 55% similar to a fumarate hydratase precursor
domain represented by FUMH_RHIOR, residues 23-119, 131-212 support
this assignment, e.g. FUMC_BRAJA.


Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 9 to 339 (E-value = 1.2e-141) place CT855 in the Lyase_1 family which is described as Lyase (PF00206)

PDB Hit:
gi|1942160|pdb|1FUO|A Chain A, Fumarase C With Bound Citrate Lyase, Tricarboxylic Acid Cycle Mol_id: 1; Molecule: Fumarase C; Chain: A, B; Synonym: Fumc; Ec: 4.2.1.2; Engineered: Yes

Gene Protein Sequence:
MRQENDSLGIVLVPEDKLFGAQTGRSQEFFSYGKESMPLEIIHALVKIKK
CAAKANGDLGCLDAKRRDMIVAATDEILSGEFDEHFPLKVWQTGSGTQSN
MNVNEVIANLAIQRHGGELGSKHPVHPNDHVNKSQSSNDVFPTAMHIAAV
QSIKGSLIPALEHLKKVIDAKALEFARDIKIGRTHLMDAVPMTLGQEFSG
YSCQLHNCLERIGFSLTHLYELAIGGTAIGTGLNVPEGFVEKVIQYLRRE
TGEPFVPASNYFAALSNHDALVQAHGSLTVLACALVKIATDLSFLGSGPR
CGLGEIFFPENEPGSSIMPGKINPTQSEALQMVCSQVIGNNQSIIFSGTK
GNFELNVMKPVIIYDFLQSVNLLAGAMRSFADYFVCGLKVNKGQLQQNVE
RSLMLVTALAPVLGYDKCSKIALKAFHENLSLKEACVSLGFLSEKEFDEH
VIPGLMVGNRGHE

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGGCAAGAGAATGATAGCTTAGGAATTGTGTTGGTTCCCGAAGACAA
ACTATTTGGAGCTCAGACGGGACGTTCGCAAGAGTTTTTCTCTTATGGTA
AAGAATCCATGCCTCTTGAGATTATCCATGCATTAGTAAAAATTAAAAAA
TGTGCTGCTAAGGCGAACGGAGACTTGGGGTGCTTAGATGCTAAACGCAG
GGATATGATTGTTGCTGCTACAGATGAAATTCTCTCCGGAGAATTTGATG
AACACTTCCCTTTAAAGGTTTGGCAGACAGGAAGCGGCACTCAAAGCAAT
ATGAATGTCAATGAGGTGATTGCTAATTTAGCAATTCAGCGTCATGGGGG
AGAGCTTGGAAGTAAACATCCCGTGCATCCCAATGATCACGTGAATAAAT
CCCAGTCCTCAAATGATGTTTTCCCAACGGCAATGCATATAGCTGCGGTA
CAAAGTATAAAAGGATCTTTAATTCCGGCATTGGAACATTTAAAAAAAGT
TATTGATGCTAAAGCTTTAGAGTTTGCTCGAGATATAAAAATTGGAAGAA
CGCATTTGATGGATGCAGTTCCAATGACTCTTGGGCAAGAGTTTTCTGGG
TATAGTTGTCAGTTGCATAATTGTTTAGAGCGGATAGGATTTTCTTTAAC
TCACCTCTATGAGTTGGCTATTGGAGGGACTGCTATTGGAACAGGGTTAA
ATGTTCCTGAAGGATTTGTAGAGAAGGTGATTCAGTATTTGAGAAGGGAG
ACAGGAGAGCCCTTTGTTCCAGCTTCGAACTACTTTGCTGCGTTATCGAA
TCATGATGCTTTGGTGCAAGCTCACGGATCATTGACTGTGTTAGCTTGTG
CTTTGGTTAAAATTGCTACAGATCTAAGTTTTTTGGGGTCAGGACCTCGT
TGTGGATTAGGGGAAATTTTCTTTCCGGAGAACGAGCCAGGATCTTCGAT
CATGCCTGGGAAAATTAACCCGACGCAAAGCGAAGCTTTACAGATGGTTT
GTTCTCAAGTAATCGGGAACAACCAGTCCATTATTTTTTCTGGAACAAAA
GGGAACTTCGAACTGAATGTCATGAAACCTGTCATTATCTATGATTTTCT
ACAGTCAGTGAACTTATTAGCTGGTGCTATGAGATCTTTTGCCGATTATT
TTGTTTGCGGACTCAAGGTAAATAAGGGGCAACTACAGCAAAATGTAGAA
AGATCTTTGATGTTAGTAACGGCATTAGCTCCCGTTTTGGGGTACGATAA
ATGTTCAAAGATCGCTTTGAAAGCTTTTCATGAAAATTTGAGTCTTAAAG
AAGCATGCGTCTCTTTAGGCTTTTTGTCTGAAAAAGAGTTTGATGAGCAT
GTGATTCCAGGATTGATGGTAGGAAATAGAGGACACGAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy