Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR707 IGR711 IGR709.1 IGR708 IGR713 IGR710 IGR706 IGR712 IGR709 CT849 CT848 CT847 CT853 CT852 CT846 map, - CT851 CT854 CT849.1 yfhC, - CT844 CT850 fumC, - CT855 CT849 CT848 CT847 CT853 CT852 CT846 map, - CT851 CT854 CT849.1 yfhC, - CT844 CT850 fumC, - CT855 CT849 CT848 CT847 CT853 CT852 CT846 map, - CT851 CT854 CT849.1 CT850 fumC, - CT855 CT845 yfhC, - CT844 CT845
* Calculated from Protein Sequence

Gene ID: CT851

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
map  

Definition:
methionine aminopeptidase

Gene Start:
1001244

Gene Stop:
1000372

Gene Length:
873

Molecular Weight*:
32627

pI*:
6.49

Net Charge*:
-4.28

EC:
3.4.11.18  

Functional Class:
translation; protein modification  

Pathway: pathway table

Secondary Evidence:
Suh JW, Boylan SA, Oh SH, Price C. Genetic and transcriptional
organization of the Bacillus subtilis spc-alpha region. Gene
169(1):17-23. Medline: 8635744.

Chang, S.-Y., E.C. McGary, S. Chang. 1989. Methionine aminopeptidase gene of Escherichia coli is essential for cell growth. J.Bacteriol. 171:4071-4072. Medline: 2544569.

Ben-Bassat, A., K. Bauer, S.-Y. Chang, K. Myambo, A. Boosman, S. Chang. 1987. Processing of the initiation methionine from proteins: properties of the Escherichia coli methionine aminopeptidase and its gene structure. J.Bacteriol. 169:751-757. Medline: 3027045.

Comment:
Methionine aminopeptidase is responsible for the removal of the amino-terminal methionine from nascent eukaryotic cytosolic and prokaryotic cytoplasmic proteins hen the penultimate amino acid is small and uncharged. All MAPs studied to date are monomeric proteins that require cobalt ions for activity. Map appears to be a monomer and belongs to the M24A peptidase family, also known as the MAP family 1.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to methionine aminopeptidase sequences,
e.g. residues 41-288 are 44% similar to AMPM_ECOLI.

CT851 is orthologously related to CPn1009: residues 1-290 of CT8519 are 73% similar to residues 1-290 of CPn100, a predicted methionine aminopeptidase from C. pneumoniae. Residues
41-287 are 31% similar to TP0842, a predicted methionine aminopeptidase in T. pallidum. CT851 is also similar to MG172 in M. genitalium. This protein is similar to PG1672, a predicted methionine aminopeptidase from Porphyromonas gingivalis.

COGS Summary:  COGS Search
BeTs to 15 clades of COG0024
COG name: Methionine aminopeptidase
Functional Class:  J
The phylogenetic pattern of COG0024 is amtkYqvCeBRhujgpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 41-80, 100-121, 126-154, 139-191, 179-224, 232-285 are
matched to blocks BL00680A,B,C,D,E, concerned with methionine
aminopeptidase subfamily 1 domains, represented by AMPM_ECOLI.
Residues 205-217, 232-246 are matched to blocks BL00491B,C,
concerned with Aminopeptidase P and proline dipeptidase proteins,
represented by AMPP_MYCGE.

ProDom Summary:  Protein Domain Search
Residues 48-236 are 45% similar to a putative methionine aminopeptidase A domain represented by AMP1_SYNY3.
Also, residues 243-287 are 51% similar to a methionine aminopeptidase domain represented by AMPM_ECOLI.

Paralogs:  Local Blast Search
CT851 is paralogously related to CT574, residues 43-242 are 26% similar to CT574, a predicted aminopeptidase.
CT851 is weakly paralogous to CT141, residues 3-18 are 75% similar to CT141, a predicted secA fragment.

Pfam Summary:  Pfam Search
Residues 3 to 23 (E-value = 4.4e-10) place CT851 in the SEC-C family which is described as SEC-C motif (PF02810)
Residues 204 to 277 (E-value = 2.2e-07) place CT851 in the Peptidase_M24 family which is described as metallopeptidase family M24 (PF00557)

PDB Hit:
gi|494313|pdb|1MAT| methionine aminopeptidase (E.C.3.4.11.18)

Gene Protein Sequence:
MKRNDPCWCGSNKKWKHCHYPTKPERPLDNLRQLYASRYDIIIKTPEQIE
KIRKACQVTAHILDALCEAAKEGVTTNELDLLSRELHKRHNAIPAPLNYG
HPPFPKTICTSLNEVICHGIPNDIPLQNGDIMNIDVSCIVDGFYGDCSRM
VMIGEVSEIKRKVCEASLEALNAAISILEPNLPLYEIGEVIENCAAKYGF
SVVDQFVGHGVGVKFHENPFVAHHRNSCKIPLAPGMIFTIEPMINVGKKE
GFIDPINHWEARTCDHQPSAQWEHAILITDSGCEVLTLLDK

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAGAAACGATCCTTGCTGGTGCGGCAGTAACAAAAAATGGAAACA
CTGCCATTACCCAACTAAACCAGAACGTCCCCTTGATAATTTACGACAAC
TTTACGCCTCTCGTTATGATATCATTATCAAAACGCCAGAACAGATAGAA
AAGATTCGTAAAGCTTGCCAAGTTACAGCTCATATTCTCGATGCTTTATG
CGAAGCTGCTAAGGAAGGGGTAACTACAAACGAACTAGATCTTCTCTCTC
GAGAGTTACATAAACGCCATAATGCCATTCCAGCTCCTCTTAATTATGGC
CATCCGCCTTTTCCAAAAACAATCTGTACATCACTGAATGAAGTCATTTG
CCACGGCATCCCCAATGATATCCCATTACAAAATGGGGACATTATGAACA
TTGATGTTTCCTGCATTGTCGATGGATTCTATGGAGATTGCAGCCGAATG
GTGATGATTGGAGAAGTCTCTGAGATCAAAAGAAAAGTCTGTGAAGCTTC
TCTAGAAGCTCTTAATGCTGCTATCTCTATTCTCGAACCTAACCTTCCTC
TGTATGAAATTGGCGAAGTGATTGAAAATTGTGCAGCTAAATATGGCTTC
TCTGTTGTTGACCAGTTTGTTGGACACGGAGTGGGAGTCAAGTTTCATGA
AAATCCTTTTGTGGCACACCATAGAAACTCTTGTAAAATCCCTCTAGCAC
CTGGAATGATCTTCACTATCGAGCCTATGATCAATGTCGGAAAGAAAGAA
GGGTTTATTGACCCAATAAACCATTGGGAGGCACGAACATGTGACCACCA
GCCTAGTGCACAATGGGAACATGCTATTCTGATTACCGATTCTGGTTGTG
AAGTACTAACTCTTCTAGATAAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy