Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR707 IGR709.1 IGR708 IGR704 IGR706 IGR705 IGR703 IGR709 rs15, - CT843 CT849 CT848 CT847 CT846 map, - CT851 pnp, - CT842 CT849.1 yfhC, - CT844 CT850 ftsH,hflB, - CT841 rs15, - CT843 CT849 CT848 CT847 CT846 map, - CT851 pnp, - CT842 CT849.1 yfhC, - CT844 CT850 ftsH,hflB, - CT841 rs15, - CT843 CT849 CT848 CT847 CT846 map, - CT851 pnp, - CT842 CT849.1 yfhC, - CT844 CT850 ftsH,hflB, - CT841 CT845 CT845
* Calculated from Protein Sequence

Gene ID: CT844

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
yfhC  

Definition:
cytosine deaminase

Gene Start:
995570

Gene Stop:
996058

Gene Length:
489

Molecular Weight*:
18488

pI*:
6.63

Net Charge*:
-1.22

EC:
3.5.4.1  

Functional Class:
purines, pyrimidines, nucleosides and nucleotides; pyrimidines  

Pathway: pathway table
Nucleotide Metabolism; Pyrimidine metabolism

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to hypothetical proteins many of which are bacterial:
residues 6-160 are 38% similar to a hypothetical 20 KD protein
in PURL_DPJ intergenic region, YFHC_ECOLI. No similarities to T.pallidum
or M.genitalium.

CT844 is orthologously related to CPn1001: residues 3-156 are 72%
similar to CPn1001. This protein is similar to PG666, a predicted cytosine deaminase from Porphyromonas gingivalis.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0590
COG name: Cytosine deaminase-related enzymes
Functional Class:  F
The phylogenetic pattern of COG0590 is ----Yq-CeBRh------inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 55-61, 75-92 are matched to blocks BL00903A,B,
concerned with Cytidine and deoxycytidylate deaminases zinc-binding
regions,e.g. FCY1_YEAST.

ProDom Summary:  Protein Domain Search
Residues 27-103 are 43% similar to a cytosine deaminase domain, e.g. FCY1_YEAST.
Residues 26-74,78-100 are 42% and 60% similar to protein region
intergenic domain HI0906, e.g. YAAJ_BACSU.
Residues 10-61 are 37% similar to a hypothetical 28.3 KD protein domain, e.g. YJD5_YEAST.

Paralogs:  Local Blast Search
CT844 is weakly paralogous to CT730, a riboflavin-specific diaminase:
residues 4-85 are 30% similar to CT730.

Pfam Summary:  Pfam Search
Residues 4 to 104 (E-value = 2.5e-43) place CT844 in the dCMP_cyt_deam family which is described as Cytidine and deoxycytidylate deaminase zinc-binding region (PF00383)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
136  
163

PDB Hit:
None.

Gene Protein Sequence:
MCIEKDLFFMKKALDEARKAYEQDEVPVGCIIVHGDKIIARGHNSVEQLK
DPTVHAEMICISAAAEYLENWRLKDTILYCTLEPCLMCAGAIQLARIPRI
VWGAPDLRLGAGGSWLNVFLEKHPFHQVECCSGVCYQESEQLMKNFFLEK
RKAKDEGRNSRAT

Gene Nucleotide Sequence:  Sequence Viewer
ATGTGTATAGAAAAAGATTTATTTTTCATGAAGAAGGCTCTAGATGAGGC
TAGGAAGGCATATGAACAAGATGAAGTCCCTGTTGGTTGTATCATCGTTC
ATGGAGATAAGATCATCGCTAGAGGACATAATAGTGTTGAGCAATTAAAA
GATCCGACAGTACATGCTGAAATGATTTGTATTAGTGCAGCAGCAGAATA
TCTAGAGAATTGGAGATTGAAAGACACGATCCTCTACTGTACTTTAGAGC
CCTGTCTCATGTGTGCTGGAGCGATTCAGTTAGCACGTATTCCTAGAATT
GTTTGGGGGGCTCCTGATTTGCGTTTAGGAGCTGGAGGGAGTTGGTTAAA
TGTTTTTTTAGAAAAACATCCTTTCCATCAAGTAGAGTGTTGTTCTGGTG
TTTGTTACCAAGAGTCTGAGCAGTTAATGAAAAACTTTTTTTTAGAGAAG
AGAAAGGCTAAGGATGAAGGAAGAAATTCTCGCGCTACT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy