Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR699 IGR700 IGR704 IGR701 IGR705 IGR702 IGR703 rs15, - CT843 CT846 CT839 CT838 pnp, - CT842 yfhC, - CT844 CT840 CT837 ftsH,hflB, - CT841 rs15, - CT843 CT846 CT839 CT838 pnp, - CT842 yfhC, - CT844 CT840 CT837 ftsH,hflB, - CT841 rs15, - CT843 CT846 CT839 CT838 pnp, - CT842 yfhC, - CT844 CT840 CT837 ftsH,hflB, - CT841 CT845 CT845
* Calculated from Protein Sequence

Gene ID: CT841

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ftsH  hflB  

Definition:
FtsH-related ATPase protease

Gene Start:
990003

Gene Stop:
992741

Gene Length:
2739

Molecular Weight*:
101615

pI*:
6.12

Net Charge*:
-9.78

EC:
3.4.24.-  

Functional Class:
cellular processes; cell division  

Pathway: pathway table

Secondary Evidence:
Akiyama, Y., T. Yoshihisa, K. Ito 1995. FtsH, a membrane-bound ATPase, forms a complex in the cytoplasmic membrane of Escherichia coli. J.Biol.Chem. 270:23485-23490. Medline: 7559511.

Akiyama, Y., A. Kihara, H. Tokuda, K. Ito 1996. FtsH (HflB) is
an ATP-dependent protease selectively acting on SecY and some other membrane proteins. J.Biol.Chem. 271:31196-31201. Medline: 8940120.

Comment:
The FtsH homolog of B.subtilis apparently functions as an ATP-dependent
zinc metalloprotease involved in the degradation of sigma-32.
It is an integral membrane protein. FtsH is a member of the AAA family of ATPases
and belongs to the M41 peptidase family (zinc metalloproteases).

This sequence contains the MAxxxST motif associated with antigenic mimicry to a
heart muscle-specific alpha myosin heavy chain sequence, and implicated in
autoimmune myocarditis. See Bachmaier et al., 1999. Science 283(5406): 1335-9. Chlamydia Infections and Heart Disease Linked Through Antigenic Mimicry (Medline: 10037605).

See CT443.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to cell division protein sequences, specifically FTSM homologs,
e.g. residues 396-903 are 49% similar to the protein FTH1_HAEIN. Residues 375-873 are 53% similar to a cell division protein from B.burgdorferi (AE001177).
Residues 376-882 are 48% similar to a cell division protein from T.pallidum (TP0765).
No similarities were discovered for the N-terminus using Psi-BLAST. CT841 is also similar to MG457,
a predicted cell division protein in M.genitalium.

CT841 is orthologously related to CPn0998: residues 1-912 of CT841 are 79%
similar to residues 1-910 of CPn0998, a predicted FtsH-related ATPase protease from
C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0465
COG name: ATP-dependent Zn proteases
Functional Class:  O
The phylogenetic pattern of COG0465 is ----YqvCeBrHUJgpoLinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 425-440, 459-480, 498-534, 552-597, 629-649, 821-866 are matched to blocks BL00674A-E,
concerned with AAA-family sequences, e.g. FTH1_SYNY3, FTH1_HAEIN, FTSH_BACSU.
Residues 461-476 are similar to block PR00819B, which encompasses CBXX/CFQX superfamily
sequences, e.g. MTY15F1026. Residues 359-378 match block PR00500F, polycystic kidney
disease signature, e.g. A56520.

ProDom Summary:  Protein Domain Search
Residues 710-861 are 38% similar to an FTSH domain as observed in FTSH_ECOLI.
Residues 427-535, 497-529, 570-646, 677-709 support this as evidenced by similarities to
FTSH_ECOLI, FTH1_HAEIN, etc.


Paralogs:  Local Blast Search
CT841 is not obviously paralogous to any C.trachomatis protein. Residues
427-531 are 29% similar to a stretch of CT344, a putative ATP protease.
Residues 462-532 are 40% similar to a stretch of CT705, also an ATPase protease.

Pfam Summary:  Pfam Search
Residues 288 to 435 (E-value = 1.8e-36) place CT841 in the FtsH_ext family which is described as FtsH Extracellular (PF06480)
Residues 461 to 648 (E-value = 2.1e-90) place CT841 in the AAA family which is described as ATPase family associated with various cellular activities (AAA) (PF00004)
Residues 654 to 864 (E-value = 8.4e-125) place CT841 in the Peptidase_M41 family which is described as Peptidase family M41 (PF01434)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
20  
36
coil-coil  
281  
322
transmembrane  
378  
395
non-globular  
605  
686
coil-coil  
807  
859

PDB Hit:
none

Gene Protein Sequence:
MAKDKKTNPESKKSFPTAFFFLLFGVIFGVVTVQNFFSAKKASVGFSHQL
EHLVNLKLLIPEESRKTALNDNLVSFSGRFREVVPAEGQVRYQYLDLIER
KHQIDFELEEASKSLTVLSKEVRNAITWFSAISGMPIPEAGYTISPRTDV
GLSVLEPLVVYGPVDAQIVNLAALENRVRSLPKSTESLRVFGSDLYALIG
KYLSPALGIGSESLKKEIKDLHQQVENSLTQVIEGDQAVALYKTVLETLH
RISLALVSPEEGTRFHQLRSVRLYREDFNRCVKLLGESDETQVQLDKLRG
ELVQAVWYFNNQELSSRALEKQDPEVFSRWFEGAKQEWAAFSSNKSLSFR
APDQPRNLVLEKTFRSEEPTPHYSGYLFTFMPIILVLLFIYFIFSRQVKG
MNGSAMSFGKSPARLLAKGQNKVTFADVAGIEEAKEELVEIVDFLKNPTK
FTSLGGRIPKGILLIGAPGTGKTLIAKAVAGEADRPFFSIAGSDFVEMFV
GVGASRIRDMFEQAKRNAPCIIFIDEIDAVGRHRGAGIGGGHDEREQTLN
QLLVEMDGFGTNEGVILMAATNRPDVLDKALLRPGRFDRRVVVNLPDIKG
RFEILAVHAKRIKLDPTVDLMAVARSTPGASGADLENLLNEAALLAARKD
RTAVTAVEVAEARDKVLYGKERRSLEMDAQEKKTTAYHESGHAIVGLCVE
HSDPVDKVTIIPRGLSLGATHFLPEKNKLSYWKKELYDQLAVLMGGRAAE
QIFLGDVSSGAQQDIAQATKIVRSMICEWGMSDHLGTVAYDERSEAAPTG
YGSCHEKNYSEETAKAIDNELKTLLDAAYQRALDIINSHKEELELMTQML
IEFETLDSKDVKEIMDHSWDADKKQARMKEEGMLYKKISEDLPPPPPQEN
VQDGTSLKFNTST

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTAAAGATAAAAAAACAAATCCAGAATCCAAAAAAAGTTTTCCTAC
TGCTTTTTTCTTTCTCTTGTTCGGAGTGATTTTTGGCGTAGTCACAGTTC
AAAACTTTTTCTCTGCTAAAAAGGCTTCGGTAGGCTTCAGTCATCAACTC
GAACATCTTGTTAACCTGAAATTACTCATTCCAGAAGAGAGTCGCAAGAC
TGCCTTGAACGATAATTTAGTGTCATTTAGTGGTCGTTTCCGCGAGGTGG
TCCCTGCTGAAGGTCAGGTTCGGTATCAATATCTTGATCTTATTGAACGT
AAGCATCAGATCGACTTTGAGCTGGAAGAGGCGAGTAAGTCTTTAACGGT
TTTATCAAAAGAAGTGCGTAATGCGATCACTTGGTTTTCAGCTATTTCTG
GAATGCCTATCCCTGAAGCAGGCTATACTATTTCTCCTCGAACGGATGTT
GGGCTCTCTGTTTTAGAACCTTTAGTGGTTTACGGCCCTGTAGATGCTCA
AATTGTGAACCTTGCTGCGCTAGAAAATCGGGTGCGCTCTTTGCCTAAAT
CTACAGAAAGTCTTAGAGTTTTTGGTTCGGATCTCTATGCATTAATTGGG
AAATATCTTTCTCCAGCTCTTGGTATCGGGTCTGAATCCTTAAAAAAAGA
AATCAAAGATTTGCATCAGCAAGTAGAAAACTCCTTAACTCAGGTTATAG
AAGGGGATCAGGCTGTTGCTTTGTATAAAACTGTGCTTGAGACGTTGCAT
AGAATTTCCTTAGCACTAGTTTCTCCTGAAGAAGGGACTCGTTTCCATCA
ATTACGCTCTGTACGTCTATATCGTGAAGATTTCAACCGATGTGTCAAAT
TATTAGGGGAGAGTGATGAGACTCAGGTGCAGCTCGATAAGTTGAGAGGC
GAATTAGTCCAAGCTGTTTGGTATTTCAATAACCAAGAACTCTCTTCTCG
AGCTTTGGAGAAACAAGATCCTGAAGTGTTTAGTCGTTGGTTTGAAGGCG
CTAAACAGGAATGGGCAGCATTCTCTTCAAATAAATCTTTATCATTTAGA
GCTCCAGATCAACCGCGTAATTTAGTTTTAGAGAAGACTTTCAGAAGTGA
AGAGCCAACGCCTCATTACTCTGGTTATTTATTCACTTTTATGCCAATTA
TTTTGGTTCTGCTGTTTATCTACTTTATCTTTTCTCGTCAGGTCAAAGGG
ATGAACGGTTCTGCTATGTCGTTCGGAAAATCTCCTGCGCGCTTGTTAGC
AAAAGGACAAAACAAAGTAACTTTTGCGGATGTAGCAGGGATAGAGGAAG
CCAAAGAAGAACTCGTTGAGATCGTAGATTTCTTGAAGAATCCTACTAAA
TTTACTAGTTTAGGGGGGCGTATCCCTAAAGGAATTCTTCTCATAGGAGC
TCCAGGGACAGGGAAAACATTGATAGCTAAGGCTGTCGCTGGTGAGGCTG
ATCGACCTTTCTTCTCCATAGCCGGTTCTGATTTCGTTGAAATGTTTGTT
GGGGTTGGAGCAAGTAGAATCCGAGATATGTTCGAGCAGGCGAAGCGTAA
TGCTCCTTGCATTATCTTCATTGATGAAATCGACGCAGTTGGAAGACATC
GTGGTGCTGGTATTGGAGGTGGTCATGACGAGAGAGAGCAGACTCTAAAC
CAGCTGTTAGTAGAAATGGATGGTTTTGGTACTAACGAAGGAGTCATCCT
TATGGCTGCTACCAACCGGCCGGATGTTTTGGACAAGGCTTTGTTGCGTC
CAGGACGTTTTGATCGTCGTGTTGTTGTGAATCTTCCTGATATAAAAGGT
CGTTTTGAAATTCTCGCTGTCCACGCCAAACGCATTAAGCTAGATCCTAC
TGTAGATCTTATGGCGGTTGCGCGTAGCACTCCAGGAGCTTCAGGAGCTG
ATTTGGAAAATCTTCTTAACGAAGCAGCATTATTGGCTGCTAGAAAAGAT
CGTACAGCGGTGACAGCAGTTGAAGTTGCAGAAGCTCGAGACAAGGTTCT
GTATGGTAAAGAACGGCGTAGTTTAGAGATGGATGCTCAAGAGAAAAAAA
CAACGGCATACCACGAGTCAGGGCATGCTATTGTAGGGCTTTGTGTTGAG
CATTCGGATCCTGTAGATAAGGTGACGATTATTCCAAGAGGCTTATCTTT
AGGAGCCACGCATTTCCTTCCAGAAAAAAATAAATTAAGCTACTGGAAGA
AAGAGCTTTATGATCAGTTAGCGGTTCTTATGGGAGGCCGTGCTGCTGAA
CAGATTTTCCTCGGTGATGTTTCTAGTGGAGCGCAACAAGATATTGCTCA
GGCAACAAAGATTGTACGGAGCATGATTTGTGAATGGGGAATGAGCGATC
ATTTAGGAACTGTAGCTTATGACGAGCGTTCCGAAGCGGCTCCTACAGGA
TATGGATCCTGCCATGAAAAAAATTACTCTGAAGAGACGGCCAAAGCTAT
TGATAATGAACTTAAAACTCTATTGGATGCTGCATATCAAAGAGCTTTGG
ACATCATCAACAGTCATAAAGAAGAGTTAGAGCTTATGACACAGATGTTG
ATAGAATTCGAGACTTTGGATTCTAAAGATGTTAAAGAAATCATGGACCA
TTCTTGGGATGCTGATAAGAAACAGGCTCGTATGAAGGAAGAAGGCATGC
TGTATAAGAAGATTTCTGAAGATCTTCCACCGCCGCCTCCTCAAGAAAAT
GTGCAAGATGGGACGAGTTTGAAGTTTAATACTAGCACA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy