Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Ser-4 IGR699 IGR700 IGR697 IGR701 IGR702 IGR703 IGR698 CT839 CT838 pnp, - CT842 rl20, - CT835 CT840 pheS, - CT836 CT837 ftsH,hflB, - CT841 CT839 CT838 pnp, - CT842 rl20, - CT835 CT840 pheS, - CT836 CT837 ftsH,hflB, - CT841 CT839 CT838 pnp, - CT842 CT840 pheS, - CT836 CT837 ftsH,hflB, - CT841 rl20, - CT835
* Calculated from Protein Sequence

Gene ID: CT839

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (basic)

Gene Start:
988779

Gene Stop:
987718

Gene Length:
1062

Molecular Weight*:
40053

pI*:
9.72

Net Charge*:
12.77

EC:
 

Functional Class:
unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Partial hits in gapped BLAST to hypothetical proteins from bacteria, e.g.
residues 39-106 are 25% similar to a hypothetical from Synechocystis (D64006)
Residues 114-228 are 23% similar to a hypothetical from M.jannaschii (E64495).
Residues 8-103 are 21% similar to a hypothetical integral membrane protein of
T.pallidum (TP0884). No similarity to M.genitalium.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0795
COG name: Predicted permeases
Functional Class:  R
The phylogenetic pattern of COG0795 is ------vCE--HUJ--OLINx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 100-125 and 269-293 are weakly matched (95%) to blocks PR00779D,I, involved in
inositol 1,4,5-triphosphate sequences, e.g. IP3S_RAT.

ProDom Summary:  Protein Domain Search
Residues 3-106 are 26% similar to a hypothetical domain from YJGP_HAEIN.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 6 to 353 (E-value = 2.6e-79) place CT839 in the YjgP_YjgQ family which is described as Predicted permease YjgP/YjgQ family (PF03739)

Structural Feature(s):
Feature Type  Start  Stop
gram positive/gram negative signal  
1  
34
transmembrane  
46  
76
transmembrane  
93  
120
transmembrane  
269  
289
transmembrane  
302  
320
transmembrane  
324  
342

PDB Hit:
none

Gene Protein Sequence:
MPILWKVLIFRYLKTTVFCTLSLICISIISSLQEIVSYIAKDVPYATVFK
VTAYQIPYLLPFILPASCFISAFTLFRKLSDNNQITFLKASGASQGMIIF
PVLIASGVLCCFNFYTCSELASICRFQTGKEIANIAMTSPALLLQTLQKK
ENDRIFIAIDHCGKSKFDNVVIALKHNQEISNIGFIETIIPDVNKDSVQA
KNVLVISKIPLFSEARTSNPNEFYLETLDEFLIPKITATLFAGKSYMKTR
TDYLPWKQLIQDARLHLAEILRRIAIGLLCSTMTFSGLALGTYKPRFRKP
VLIYALFPILNLIFLIVGKNTIHPISAVMLFLFPQLLSWLIFSWRIYTEN
QGHA

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCTATTCTATGGAAAGTTCTTATTTTCCGTTATTTAAAAACCACAGT
TTTCTGTACGCTTAGCCTAATCTGCATTTCTATCATCAGTTCTCTGCAAG
AAATTGTCAGTTATATTGCTAAAGATGTTCCTTATGCGACAGTTTTTAAA
GTCACTGCCTACCAAATTCCCTATCTCCTTCCCTTTATACTCCCAGCATC
TTGCTTTATCTCGGCCTTTACCTTATTTCGTAAACTCTCCGATAATAACC
AAATTACCTTTTTAAAAGCTTCTGGAGCTTCTCAAGGAATGATTATCTTC
CCTGTTTTGATTGCTTCAGGAGTATTATGTTGCTTCAATTTCTATACATG
TTCCGAGTTAGCTTCGATTTGCCGCTTTCAAACAGGGAAAGAAATCGCAA
ATATCGCTATGACATCCCCGGCACTTTTGTTACAAACCTTGCAGAAAAAA
GAAAACGATCGCATATTCATTGCGATAGATCACTGTGGGAAAAGTAAATT
TGACAATGTAGTTATTGCTTTAAAACACAATCAAGAGATATCCAATATTG
GTTTCATTGAGACGATTATTCCTGATGTGAATAAAGATTCTGTTCAGGCG
AAAAATGTCCTAGTCATTTCCAAAATCCCTCTCTTTTCAGAGGCTCGCAC
ATCTAATCCCAATGAGTTCTATCTAGAAACTCTGGATGAATTCCTTATTC
CGAAAATTACAGCCACGCTATTCGCTGGGAAATCGTATATGAAAACTCGT
ACAGACTATTTGCCTTGGAAACAGTTAATCCAAGATGCTCGTTTGCATTT
AGCAGAAATACTCCGTAGAATTGCTATCGGCCTATTATGTAGTACTATGA
CTTTCTCTGGATTAGCCCTAGGAACTTATAAGCCACGTTTCCGTAAGCCC
GTGCTAATTTATGCCTTATTCCCTATACTGAATCTCATTTTCCTTATCGT
AGGGAAAAATACTATCCATCCAATTTCAGCTGTAATGCTGTTTCTCTTTC
CACAGCTCCTCTCATGGCTTATTTTTTCTTGGAGAATATACACTGAAAAT
CAGGGGCATGCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy