Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Val-2 tRNA-Ser-4 IGR699 IGR692 IGR700 IGR697 IGR695 IGR696 IGR691 IGR693 IGR698 IGR690 IGR694 CT832 murB, - CT831 CT839 CT838 rl35, - CT834 rl20, - CT835 yggH, - CT829 infC, - CT833 ytgB, - CT830 pheS, - CT836 nrdB, - CT828 CT837 CT832 murB, - CT831 CT839 CT838 rl35, - CT834 rl20, - CT835 yggH, - CT829 infC, - CT833 ytgB, - CT830 pheS, - CT836 nrdB, - CT828 CT837 CT832 murB, - CT831 CT838 CT839 rl20, - CT835 yggH, - CT829 infC, - CT833 ytgB, - CT830 pheS, - CT836 nrdB, - CT828 CT837 rl35, - CT834
* Calculated from Protein Sequence

Gene ID: CT834

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rl35  

Definition:
50S ribosomal protein L35

Gene Start:
982710

Gene Stop:
982901

Gene Length:
192

Molecular Weight*:
7326

pI*:
12.67

Net Charge*:
17.21

EC:
 

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Molecular Assembly; Ribosome assembly

Comment:
new record L35 Ribosomal Protein

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to RL35 sequences, e.g. residues 1-62 are 43%
similar to RL35_BACSU. CT834 is weakly similar to TP0849, a predicted L35 sequence in T.pallidum.
It is also similar to MG197 in M.genitalium.

CT834 is orthologously related to CPn0991 and
they share 90% similarity.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0291
COG name: Ribosomal protein L35
Functional Class:  J
The phylogenetic pattern of COG0291 is ----yqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 2-20 and 26-64 are matched to blocks BL00936A,B, concerned with L35
proteins, e.g. RL35_BACSU.

ProDom Summary:  Protein Domain Search
Residues 4-52 are 44% similar to an RL35 domain of RK35_SPIOL. Residues
5-52 are 37% similar to a chromosomal protein domain of STP4_PIG.

Paralogs:  Local Blast Search
No paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 4 to 62 (E-value = 2.3e-11) place CT834 in the Ribosomal_L35p family which is described as Ribosomal protein L35 (PF01632)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
11

PDB Hit:
none

Gene Protein Sequence:
MPKMKSNKSVAARFKLTGSGQLKRTRPGKRHKLSKRSSQQKRNLSKQPLV
DQGQVGMYKRMMLV

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCCAAGATGAAAAGCAATAAGTCCGTTGCGGCGCGTTTCAAATTGAC
TGGTTCTGGTCAATTAAAAAGAACTCGTCCGGGGAAAAGACACAAATTAT
CAAAAAGATCTTCGCAACAGAAACGCAACCTGTCTAAACAGCCTTTAGTG
GATCAAGGTCAGGTGGGCATGTATAAGCGAATGATGCTCGTT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy