Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Val-2 tRNA-Ser-4 IGR692 IGR697 IGR695 IGR696 IGR689 IGR691 IGR693 IGR698 IGR690 IGR694 CT832 murB, - CT831 rl35, - CT834 rl20, - CT835 yggH, - CT829 infC, - CT833 ytgB, - CT830 pheS, - CT836 nrdB, - CT828 CT837 nrdA, - CT827 CT832 murB, - CT831 rl35, - CT834 rl20, - CT835 yggH, - CT829 infC, - CT833 ytgB, - CT830 pheS, - CT836 nrdB, - CT828 CT837 nrdA, - CT827 CT832 murB, - CT831 rl20, - CT835 yggH, - CT829 infC, - CT833 ytgB, - CT830 pheS, - CT836 nrdB, - CT828 CT837 nrdA, - CT827 rl35, - CT834
* Calculated from Protein Sequence

Gene ID: CT831

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
murB  

Definition:
UDP-N-acetylmuramate dehydrogenase

Gene Start:
981102

Gene Stop:
980230

Gene Length:
873

Molecular Weight*:
31666

pI*:
9.80

Net Charge*:
7.06

EC:
1.1.1.158  

Functional Class:
cell envelope; peptidoglycan  
central intermediary metabolism; amino sugars  

Pathway: pathway table
Nucleotide Metabolism; Aminosugars metabolism

Comment:
The MURB protein is involved in cell wall (peptidoglycan) biosynthesis,
reducing UDP-N-acetylmuramate to UDP-N-acetyl-3-O-(1-carboxyvinyl)-D-glucosamine.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to murB sequences, e.g. residues 14-287 are 37% similar to MURB_BACSU.
Residues 15-290 are 33% similar to a UDP-N-acetylmuramate dehydrogenase from B.burgdorferi (AE001161).
Residues 10-284 are 29% similar to this enzyme from T.pallidum (TP0090). No simiularity
to M.genitalium.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0812
COG name: UDP-N-acetylmuramate dehydrogenase
Functional Class:  M
The phylogenetic pattern of COG0812 is -----Qvcebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 68-81 and 213-225 are matched to blocks BL00911A,E, concerned with dihydroorotate dehydrogenase sequences,
e.g. PYRD_SYNY3.

ProDom Summary:  Protein Domain Search
Residues 84-283 are 44% similar to a MURB domain as observed in MURB_BACSU.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 187 to 288 (E-value = 4e-58) place CT831 in the MurB_C family which is described as UDP-N-acetylenolpyruvoylglucosamine reductase, C-terminal domain (PF02873)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
119  
152

PDB Hit:
gi|2098437|pdb|1UXY| Murb Mutant With Ser 229 Replaced By Ala, Complex With Enolpyruvyl-Udp-N-Acetylglucosamine Peptidoglycan Synthesis, Cell Wall, Cell Division, Oxidoreductase, Nadp, Flavoprotein, Fad Mol_id: 1; Molecule: Uridine Diphospho-N-Acetylenol

Gene Protein Sequence:
MTDSFPFSVQESVPLSRFSTFRIGGPARYFKELTSVSEALTVFSYLHTHP
LPYIIIGKGSNCLFDDQGFDGLVLYNNIQGQEFLSDTQIKVLSGSSFALL
GKRLSSQGFSGLEFAVGIPGTVGGAVFMNAGTTLANTAFSLINVEIIDHS
GILLSIPREKLLFSYRTSPFQKKPAFIASATFQLTKDPQAAKRAKALIEE
RILKQPYEYPSAGCIFRNPEGLSAGALIDRAGLKGLKIGGGQISEKHGNF
IINTGNACTADILELIEIIQKTLKKQGISLHKEVRIIPFRL

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCGACTCTTTCCCTTTTTCTGTTCAAGAATCTGTTCCATTAAGCCG
CTTTTCCACTTTTCGCATTGGAGGGCCTGCTCGCTACTTTAAGGAATTAA
CCTCTGTGAGTGAGGCTTTAACCGTCTTTTCCTATCTCCATACCCACCCC
TTGCCCTATATTATTATTGGAAAAGGATCCAATTGCCTTTTTGATGATCA
AGGATTTGATGGCCTTGTCTTGTATAATAATATCCAAGGACAAGAGTTCC
TCTCGGATACACAAATCAAGGTCCTTTCAGGATCTTCCTTTGCTCTGTTA
GGGAAGAGGCTTTCTTCTCAAGGATTTTCGGGATTAGAATTTGCCGTAGG
AATCCCAGGAACCGTTGGTGGAGCTGTGTTTATGAATGCTGGCACTACTC
TAGCTAACACAGCCTTTTCTCTCATCAACGTAGAAATTATTGACCATTCA
GGAATTTTACTTTCGATACCTAGGGAAAAGCTTCTTTTTTCCTATCGGAC
TTCCCCTTTTCAAAAAAAACCAGCTTTTATTGCCTCAGCGACATTTCAGC
TAACTAAGGATCCTCAGGCTGCTAAACGAGCTAAAGCTTTAATAGAAGAA
CGCATTCTAAAACAACCCTACGAATACCCTTCCGCAGGCTGTATCTTCCG
GAATCCTGAAGGCTTGTCTGCAGGAGCACTTATTGATCGAGCTGGATTAA
AAGGGTTGAAGATAGGAGGCGGGCAGATATCTGAAAAACATGGCAATTTC
ATTATTAATACCGGAAATGCCTGTACCGCAGACATCCTAGAGCTTATCGA
GATCATTCAAAAAACTCTTAAAAAACAAGGTATTTCCTTACATAAAGAAG
TCCGTATCATCCCCTTTCGCCTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy