Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Val-2 IGR692 IGR695 IGR696 IGR689 IGR691 IGR693 IGR690 IGR694 IGR688 CT832 pssA, - CT826 murB, - CT831 rl35, - CT834 rl20, - CT835 yggH, - CT829 infC, - CT833 ytgB, - CT830 nrdB, - CT828 nrdA, - CT827 CT832 pssA, - CT826 murB, - CT831 rl35, - CT834 rl20, - CT835 yggH, - CT829 infC, - CT833 ytgB, - CT830 nrdB, - CT828 nrdA, - CT827 CT832 pssA, - CT826 murB, - CT831 rl20, - CT835 yggH, - CT829 infC, - CT833 ytgB, - CT830 nrdB, - CT828 nrdA, - CT827 rl35, - CT834
* Calculated from Protein Sequence

Gene ID: CT828

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nrdB  

Definition:
ribonucleoside diphosphate reductase beta subunit

Gene Start:
977556

Gene Stop:
978593

Gene Length:
1038

Molecular Weight*:
40504

pI*:
5.28

Net Charge*:
-9.99

EC:
1.17.4.1  

Functional Class:
purines, pyrimidines, nucleosides and nucleotides; deoxyribonucleotide metabolism  

Pathway: pathway table
Nucleotide Metabolism; Purine metabolism
Nucleotide Metabolism; Pyrimidine metabolism

Comment:
In H. pylori, this enzyme catalyzes the conversion of ribonucleotides to deoxyribonucleotides. It is a tetramer composed of two alpha and two beta subunits. CT827 appears to be the alpha subunit sequence, CT828 the beta subunit sequence.

From Prosite PDOC00317:

Ribonucleotide reductase (EC 1.17.4.1) catalyzes the reductive synthesis of deoxyribonucleotides from their corresponding ribonucleotides. It provides the precursors necessary for DNA synthesis. Ribonucleotide reductase is an oligomeric enzyme composed of a large subunit (700 to 1000 residues) and a small subunit (300 to 400 residues).

The small chain binds two iron atoms (three Glu, one Asp, and two His are involved in metal binding) and contains an active site tyrosine radical. The regions of the sequence that contain the metal-binding residues and the active site tyrosine are conserved in ribonucleotide reductase small chain from prokaryotes, eukaryotes and viruses.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to ribonucleoside diphosphate reductase beta subunit sequences, e.g.
residues 14-338 are 30% similar to RIR2_HELPY. Residues 13-344 are 26% similar to a ribonucleoside diphosphate reductase beta subunit
sequence from T.pallidum (TP0053). CT828 is also similar to MG229 in M.genitalium.

CT828 is orthologously related to CPn0985: residues 1-346 are 86%
similar to CPn0985.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0208
COG name: Ribonucleotide reductase beta subunit
Functional Class:  F
The phylogenetic pattern of COG0208 is ----YQ-cEBRhujgp-linx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 33-298 span eight regions with matches to blocks BL00368A-D, concerned with ribonucleotide reductase sequences,
e.g. RIR4_YEAST, RIR2_HELPY, etc.

ProDom Summary:  Protein Domain Search
Residues 191-338 are 35% similar to a reductase domain as observed in RIR2_HELPY.
Residues 48-134, 183-247, 254-305 support this association through similarities to
RIR2_HELPY, RIR2_DROME, etc.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 20 to 319 (E-value = 2.5e-40) place CT828 in the Ribonuc_red_sm family which is described as Ribonucleotide reductase, small chain (PF00268)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
186  
207

PDB Hit:
gi|1942527|pdb|1XSM| Protein R2 Of Ribonucleotide Reductase From Mouse Oxidoreductase, Dna Replication, Iron Mol_id: 1; Molecule: Ribonucleotide Reductase R2; Chain: Null; Synonym: R2; Ec: 1.17.4.1; Engineered: Yes; Biological_unit: Heterodimer Of A Larg

Gene Protein Sequence:
MQADILDGKQKRVNLNSKRLVNCNQVDVNQLVPIKYKWAWEHYLNGCANN
WLPTEIPMGKDIELWKSDRLSEDERRVILLNLGFFSTAESLVGNNIVLAI
FKHVTNPEARQYLLRQAFEEAVHTHTFLYICESLGLDEKEIFNAYNERAA
IKAKDDFQMEITGKVLDPNFRTDSVEGLQEFVKNLVGYYIIMEGIFFYSG
FVMILSFHRQNKMIGIGEQYQYILRDETIHLNFGIDLINGIKEENPEIWT
PELQQEIVELIKRAVDLEIEYAQDCLPRGILGLRASMFIDYVQHIADRRL
ERIGLKPIYHTKNPFPWMSETIDLNKEKNFFETRVIEYQHAASLTW

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAGCAGATATTTTAGATGGAAAACAGAAACGCGTTAATCTAAATAG
CAAGCGTCTAGTGAACTGCAACCAGGTCGATGTCAACCAACTTGTTCCTA
TTAAGTACAAATGGGCTTGGGAACATTATTTGAATGGCTGCGCAAATAAC
TGGCTCCCTACAGAGATCCCCATGGGGAAAGACATCGAATTATGGAAGTC
GGATCGTCTTTCTGAAGATGAGCGGCGAGTCATTCTTTTGAATTTAGGTT
TTTTCAGCACCGCAGAGAGCTTGGTTGGGAATAATATTGTTCTAGCAATT
TTTAAACATGTAACTAATCCGGAAGCGAGACAATATCTTTTAAGACAAGC
TTTTGAAGAAGCGGTTCACACGCACACATTTTTGTATATTTGTGAGTCAC
TCGGATTAGACGAGAAAGAAATTTTCAATGCCTATAACGAGCGTGCTGCG
ATTAAGGCCAAAGATGATTTCCAGATGGAAATCACTGGCAAGGTATTAGA
TCCTAATTTTCGCACGGACTCTGTTGAGGGTCTACAGGAGTTTGTTAAAA
ACTTAGTAGGATACTACATCATTATGGAAGGGATTTTCTTCTATAGTGGG
TTTGTGATGATCCTTTCCTTCCACAGACAAAATAAGATGATTGGTATTGG
AGAACAATATCAATACATCTTAAGAGATGAGACAATCCACTTGAACTTTG
GTATTGATTTGATCAACGGGATAAAAGAAGAGAACCCGGAGATTTGGACT
CCAGAGTTACAGCAAGAAATTGTCGAATTAATTAAGCGAGCTGTCGATTT
AGAAATTGAGTATGCGCAAGACTGTCTCCCTAGAGGGATTTTGGGATTGA
GAGCTTCGATGTTCATCGATTATGTGCAGCATATTGCAGACCGTCGTTTG
GAAAGAATCGGATTAAAACCTATTTATCATACGAAAAACCCATTCCCTTG
GATGAGCGAAACAATAGACCTTAATAAAGAGAAAAACTTCTTTGAAACAA
GGGTTATAGAATATCAACATGCAGCAAGCTTAACTTGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy