Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Val-2 IGR692 IGR687 IGR686 IGR689 IGR691 IGR690 IGR688 pssA, - CT826 murB, - CT831 CT825 yggH, - CT829 ytgB, - CT830 nrdB, - CT828 CT824 nrdA, - CT827 pssA, - CT826 murB, - CT831 CT825 yggH, - CT829 ytgB, - CT830 nrdB, - CT828 CT824 nrdA, - CT827 pssA, - CT826 murB, - CT831 CT825 yggH, - CT829 ytgB, - CT830 nrdB, - CT828 CT824 nrdA, - CT827
* Calculated from Protein Sequence

Gene ID: CT827

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
nrdA  

Definition:
ribonucleoside diphosphate reductase alpha chain

Gene Start:
974357

Gene Stop:
977515

Gene Length:
3159

Molecular Weight*:
120168

pI*:
6.12

Net Charge*:
-13.74

EC:
1.17.4.1  

Functional Class:
purines, pyrimidines, nucleosides and nucleotides; deoxyribonucleotide metabolism  

Pathway: pathway table
Nucleotide Metabolism; Purine metabolism
Nucleotide Metabolism; Pyrimidine metabolism

Secondary Evidence:
Jordan A, Torrents E, Jeanthon C, Eliasson R, Hellman U, Wernstedt C, Barbe J,
Gibert I, Reichard P. 1997. B12-dependent ribonucleotide reductases from deeply
rooted eubacteria are structurally related to the aerobic enzyme from Escherichia
coli. Proc Natl Acad Sci U S A 94(25):13487-92. Medline: 9391052.

Comment:
In H. pylori, this enzyme catalyzes the conversion of ribonucleotides to deoxyribonucleotides.
It is a tetramer composed of two alpha and two beta subunits. CT827 appears to be the
alpha subunit sequence, CT828 the beta subunit sequence.

Blast Summary:  PSI-Blast Search
Hits in gapped blast to ribonucleoside diphosphate reductase sequences, e.g. residues 243-1052 are 35% similar to the mouse chain M1 sequence (A24050). Many hits were to eukaryotic proteins, however residues 243-1012 are 35% similar to RIR1_HELPY alpha subunit.

CT827 is orthologously related to CPn0984: residues 7-1053 are 75% similar to CPn0984. This protein is similar to PG1010, a predicted ribonucleotide reductase from Porphyromonas gingivalis. Residues 124-1002 are 31% similar to TP1008, a predicted ribonucleoside-diphosphate reductase from T. pallidum. CT827 is also similar to MG231 from M. genitalium.

COGS Summary:  COGS Search
BeTs to 15 clades of COG0209
COG name: Ribonucleotide reductase alpha subunit
Functional Class:  F
The phylogenetic pattern of COG0209 is a-tKYqvcEBRhujgp-linx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 375-1004 span ten regions with matches to blocks BL00089A-I, which
encompass ribonucleotide reductase sequences, e.g. RIR1_HELPY, RIR3_YEAST, RIR1_CAEEL,
etc.

ProDom Summary:  Protein Domain Search
Residues 514-872 are 39% similar to a ribonucleoside diphosphate reductase alpha subunit
domain as observed in RIR1_HELPY. Residues 17-119, 126-230, 407-509, 938-999,
940-1008 support this association as evidenced by similarities to RIR1_HELPY,
HRDD_HAEIN, etc.

Paralogs:  Local Blast Search
There is no evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 15 to 117 (E-value = 6.6e-31) place CT827 in the ATP-cone family which is described as ATP cone domain (PF03477)
Residues 124 to 225 (E-value = 6.9e-33) place CT827 in the ATP-cone family which is described as ATP cone domain (PF03477)
Residues 243 to 332 (E-value = 2.9e-08) place CT827 in the ATP-cone family which is described as ATP cone domain (PF03477)
Residues 384 to 459 (E-value = 3.9e-30) place CT827 in the Ribonuc_red_lgN family which is described as Ribonucleotide reductase, all-alpha domain (PF00317)
Residues 461 to 1002 (E-value = 5.3e-184) place CT827 in the Ribonuc_red_lgC family which is described as Ribonucleotide reductase, barrel domain (PF02867)

Structural Feature(s):
Feature Type  Start  Stop
coil-coil  
217  
249

PDB Hit:
gi|2914234|pdb|4R1R|A Chain A, Ribonucleotide Reductase R1 Protein With Substrate, Gdp And Effector Dttp From Escherichia Coli Ribonucleotide Reductase, Deoxyribonucleotide Synthesis, Radical Chemistry, Allosteric Regulation, Specificity, Complex (Oxidore

Gene Protein Sequence:
MFTRIVMVDLQEKQCTIVKRNGMFVPFDRNRIFQALEAAFRDTRRIDDHM
PLPEDLESSIRSITHQVVKEVVQKITDGQVVTVERIQDMVESQLYVNGLQ
DVARDYIVYRDDRKAHRKKSWQSLSVVRRCGTVVHFNPMKISAALEKAFR
ATDKTEGMTPSSVREEINALTQNIVAEIEECCPQQDRRIDIEKIQDIVEQ
QLMVVGHYAVAKNYILYREARARVRDNREEDGSTEKTIAEEAVEVLSKDG
STYTMTHSQLLAHLARACSRFPETTDAALLTDMAFANFYSGIKESEVVLA
CIMAARANIEKEPDYAFVAAELLLDVVYKEALGKSKYAEDLEQAHRDHFK
RYIAEGDTYRLNAELKHLFDLDALADAMDLSRDLQFSYMGIQNLYDRYFN
HHEGCRLETPQIFWMRVAMGLALNEQDKTSWAITFYNLLSTFRYTPATPT
LFNSGMRHSQLSSCYLSTVQDNLVNIYKVIADNAMLSKWAGGIGNDWTAI
RATGALIKGTNGRSQGVIPFIKVTNDTAVAVNQGGKRKGAVCVYLEVWHL
DYEDFLELRKNTGDERRRAHDVNIASWIPDLFFKRLQQKGTWTLFSPDDV
PGLHDAYGEEFERLYEEYERKVDTGEIRLFKKVEAEDLWRKMLSMLFETG
HPWMTFKDPSNIRSAQDHKGVVRCSNLCTEILLNCSETETAVCNLGSINL
VQHIVGDGLDEEKLSETISIAVRMLDNVIDINFYPTKEAKEANFAHRAIG
LGVMGFQDALYKLDISYASQEAVEFADYSSELISYYAIQASCLLAKERGT
YSSYKGSKWDRGLLPIDTIQLLANYRGEANLQMDTSSRKDWEPIRSLVKE
HGMRHCQLMAIAPTATISNIIGVTQSIEPTYKHLFVKSNLSGEFTIPNVY
LIEKLKKLGIWDADMLDDLKYFDGSLLEIERIPDHLKHIFLTAFEIEPEW
IIECASRRQKWIDMGQSLNLYLAQPDGKKLSNMYLTAWKKGLKTTYYLRS
SSATTVEKSFVDINKRGIQPRWMKNKSASAGIIVERAKKAPVCSLEEGCE
ACQ

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTTACAAGGATAGTTATGGTCGATCTACAAGAAAAGCAATGCACAAT
TGTTAAGCGCAATGGAATGTTTGTTCCTTTCGATCGGAACCGTATTTTTC
AGGCTTTAGAAGCAGCTTTTCGAGACACTCGCAGAATTGATGATCATATG
CCTTTGCCTGAAGATCTGGAAAGTTCCATACGCTCGATAACGCATCAGGT
AGTTAAAGAAGTTGTGCAAAAGATTACAGATGGACAAGTGGTTACTGTAG
AGCGTATCCAAGATATGGTTGAAAGCCAACTATATGTGAATGGTTTGCAA
GATGTTGCTCGCGATTATATTGTCTATCGCGATGACCGTAAAGCGCATCG
GAAAAAATCTTGGCAAAGCCTATCCGTTGTTCGTCGTTGTGGGACTGTTG
TACACTTTAATCCTATGAAAATTTCCGCCGCTTTGGAAAAAGCTTTCCGA
GCTACCGATAAGACTGAGGGGATGACTCCAAGTTCTGTGCGAGAGGAAAT
CAATGCTTTGACGCAAAACATTGTCGCGGAAATAGAAGAATGTTGTCCTC
AACAGGATAGACGCATTGATATCGAGAAGATTCAAGATATTGTTGAACAG
CAACTAATGGTTGTTGGGCATTATGCTGTTGCAAAGAACTATATTCTTTA
TCGAGAAGCTCGCGCTCGTGTTCGTGATAACAGAGAAGAGGACGGGAGTA
CAGAAAAGACTATAGCAGAAGAAGCTGTTGAGGTGCTCAGTAAAGACGGT
TCTACCTATACAATGACGCATTCGCAGTTGTTGGCTCATTTAGCGCGCGC
TTGTAGTCGTTTTCCAGAAACGACAGATGCGGCGCTGCTTACCGATATGG
CTTTCGCAAATTTCTATTCCGGTATCAAAGAGTCTGAAGTAGTACTGGCC
TGTATTATGGCGGCTCGTGCCAATATTGAAAAGGAGCCTGATTATGCCTT
TGTTGCTGCAGAGCTCTTACTTGACGTTGTATATAAGGAAGCGTTAGGGA
AATCGAAATATGCTGAGGATTTAGAACAAGCACATCGCGATCATTTCAAA
CGCTACATCGCAGAAGGGGATACCTATCGTCTGAATGCTGAACTGAAACA
TCTTTTTGATTTAGACGCGTTAGCCGATGCTATGGATCTATCTCGAGATC
TACAGTTTTCTTACATGGGTATTCAAAATCTGTATGATCGTTATTTTAAT
CACCACGAAGGTTGCCGTTTAGAAACTCCCCAAATTTTTTGGATGCGCGT
TGCTATGGGGTTGGCATTGAATGAGCAAGACAAGACTTCTTGGGCTATTA
CTTTTTATAATTTGCTTTCGACATTCCGATATACACCAGCTACGCCAACC
TTGTTCAATTCAGGTATGCGGCATTCTCAGTTAAGCTCTTGCTATCTTTC
CACTGTACAAGATAATTTGGTCAATATCTATAAGGTCATTGCTGATAACG
CTATGCTATCTAAGTGGGCAGGAGGGATAGGTAATGATTGGACGGCGATT
CGTGCAACAGGGGCTTTAATTAAAGGAACCAATGGAAGAAGTCAGGGAGT
AATTCCTTTTATTAAGGTGACAAATGATACAGCAGTCGCAGTGAATCAAG
GTGGTAAACGCAAGGGAGCTGTATGCGTCTATTTAGAAGTTTGGCACCTC
GACTACGAAGATTTCCTTGAATTGAGAAAGAATACAGGGGATGAGCGTCG
ACGGGCTCATGATGTCAATATAGCTAGCTGGATTCCAGATCTTTTCTTCA
AACGTTTACAGCAAAAAGGGACATGGACTCTATTCAGCCCAGATGATGTT
CCGGGATTACACGATGCTTATGGGGAAGAATTTGAGCGTTTGTACGAAGA
ATATGAGCGGAAGGTTGATACCGGAGAGATTCGGTTATTCAAGAAGGTAG
AAGCTGAAGATCTGTGGAGAAAAATGCTCAGCATGCTTTTTGAAACGGGA
CACCCATGGATGACTTTTAAAGATCCATCCAACATCCGTTCGGCTCAAGA
TCATAAAGGCGTGGTGCGTTGTTCCAATCTGTGTACGGAGATTTTGTTAA
ACTGCTCGGAGACAGAAACTGCTGTTTGTAATTTAGGATCGATTAACTTA
GTTCAACATATCGTAGGGGATGGGTTAGATGAGGAAAAACTCTCTGAGAC
GATCTCTATAGCAGTCCGTATGTTGGATAACGTGATTGATATTAACTTTT
ATCCAACAAAGGAAGCTAAAGAGGCGAACTTTGCTCACCGCGCTATTGGA
TTAGGGGTGATGGGATTCCAAGATGCCTTGTATAAGCTAGATATAAGCTA
TGCTTCGCAAGAAGCTGTAGAATTTGCTGACTACAGTTCAGAGTTGATTT
CTTACTATGCGATTCAAGCTTCTTGTCTGCTCGCTAAAGAACGAGGCACT
TACAGCTCTTATAAAGGATCGAAATGGGATAGAGGTTTGCTCCCTATTGA
TACGATTCAGTTGTTAGCGAACTATCGAGGAGAAGCAAATCTCCAGATGG
ATACGTCATCAAGAAAAGATTGGGAACCTATCCGTAGTTTGGTTAAAGAG
CATGGTATGCGACATTGTCAGCTTATGGCTATAGCTCCGACAGCGACGAT
CTCCAACATTATAGGAGTAACTCAATCTATTGAGCCAACGTACAAACATT
TGTTTGTGAAGTCTAATTTGTCCGGAGAATTCACGATTCCAAATGTGTAT
TTAATTGAGAAGTTGAAGAAATTAGGTATCTGGGATGCTGATATGTTAGA
TGACCTGAAATATTTTGATGGGTCTTTATTGGAAATCGAGCGTATACCAG
ATCACTTAAAACATATTTTCTTGACAGCTTTTGAGATTGAACCAGAATGG
ATTATCGAATGCGCGTCTCGAAGACAAAAATGGATTGATATGGGGCAATC
CCTCAACCTTTATCTTGCCCAGCCAGACGGGAAAAAACTGTCGAATATGT
ATTTAACGGCTTGGAAAAAAGGTTTGAAAACTACGTATTATCTGAGATCT
TCATCAGCAACGACCGTTGAAAAATCTTTTGTAGATATTAATAAGAGAGG
AATTCAGCCTCGTTGGATGAAGAATAAGTCTGCTTCGGCAGGAATTATTG
TTGAAAGAGCGAAGAAAGCACCTGTCTGTTCTTTGGAAGAAGGGTGTGAA
GCATGTCAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy