Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR687 IGR686 IGR689 IGR685 IGR688 pssA, - CT826 CT825 nrdB, - CT828 htrA, - CT823 CT824 nrdA, - CT827 pssA, - CT826 CT825 nrdB, - CT828 htrA, - CT823 CT824 nrdA, - CT827 pssA, - CT826 CT825 nrdB, - CT828 htrA, - CT823 CT824 nrdA, - CT827
* Calculated from Protein Sequence

Gene ID: CT826

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pssA  

Definition:
CDP-diacylglycerol-serine-O-phosphatidyltransferase

Gene Start:
973739

Gene Stop:
972951

Gene Length:
789

Molecular Weight*:
28353

pI*:
9.14

Net Charge*:
8.81

EC:
2.7.8.8  

Functional Class:
fatty acid and phospholipid metabolism  

Pathway: pathway table
Metabolism of Complex Lipids; Glycerolipid metabolism

Secondary Evidence:
Okada,M., Matsuzaki,H., Shibuya,I. and Matsumoto,K. 1994. Cloning, sequencing, and expression in Escherichia coli of the Bacillus subtilis gene for phosphatidylserine synthase. J. Bacteriol. 176 (24): 7456-7461. Medline: 95095912.

Comment:
In B.subtilis, this is an integral membrane protein responsible for adding serine to CDP-diacyglycerol.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to hypothetical proteins and to phosphatidylserine synthase sequences, e.g. residues 9-163 are 33% similar to a PssA sequence (CDP-diacylglycerol--
serine o-phosphatidyltransferase) from M. tuberculosis.

CT826 is orthologous to CPn0983: residues 1-262 are 72% similar to CPn0983. This protein is similar to PG864, a predicted
CDP-diacylglycerol-serine-O-phosphatidyltransferase from Porphyromonas gingivalis. No similarities to T. pallidum
or M. genitalium.

COGS Summary:  COGS Search
BeTs to 9 clades of COG1183
COG name: Phosphatidylserine synthase
Functional Class:  I
The phylogenetic pattern of COG1183 is amt-y----br-uj---linx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
REsidues 63-99 are matched to block BL00379, concerned with CDP-alcohol phosphatidyltransferase proteins,
e.g. PSS_HELPY.

ProDom Summary:  Protein Domain Search
Residues 55-96 are 50% similar to a phosphatidylserine synthase domain as observed in
PSS_HELPY. Residues 118-205 support this as evidenced by similarity to PSS_BACSU.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 53 to 250 (E-value = 7.1e-22) place CT826 in the CDP-OH_P_transf family which is described as CDP-alcohol phosphatidyltransferase (PF01066)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
21  
39
transmembrane  
88  
104
transmembrane  
113  
137
transmembrane  
149  
168
transmembrane  
181  
202
transmembrane  
211  
231
transmembrane  
235  
255

PDB Hit:
None.

Gene Protein Sequence:
MNRIEIDLRGKRRVVTPNAITAFGLCCGLFIIFKSVLKTSSSLELMHRLQ
GLSLLLISAMIADFSDGAVARIMKAESAFGAHFDSLSDAITFGIAPPLIA
IKSLNGEYGGTFCSSFLLLTCIIYSLCGVLRLVRYNLFAATGEKATTFTG
LPIPAAAACVVSLGVLLASDTLNSLPERARVLLVSLGLLLSGCLMISTWR
FPGLKHFHFRVSSSLLVLGIGLVACLFFSGLVDHFTQVFFLVSWLYVLVV
APVFSFINKRSSS

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATCGAATTGAAATAGACCTTCGTGGTAAGCGCCGAGTTGTGACCCC
TAATGCCATTACAGCTTTTGGTCTTTGCTGCGGACTCTTTATTATTTTCA
AAAGCGTGTTGAAAACTTCCTCTTCACTAGAGCTCATGCACCGCTTACAG
GGGCTCTCTCTACTCCTTATTAGCGCTATGATTGCAGATTTTTCGGATGG
AGCTGTCGCACGAATTATGAAAGCGGAAAGTGCTTTCGGTGCTCACTTCG
ATTCTTTGTCTGACGCTATCACTTTTGGCATAGCGCCTCCTTTAATTGCG
ATTAAAAGCTTGAATGGAGAATACGGCGGAACCTTTTGTTCCTCTTTCCT
CCTGCTGACTTGTATCATCTACTCTCTGTGTGGAGTACTCCGCTTAGTAC
GCTATAATCTCTTTGCCGCTACGGGAGAAAAAGCAACTACATTTACAGGA
CTTCCTATTCCTGCCGCTGCAGCATGTGTAGTCTCTTTAGGCGTGCTACT
AGCCTCTGACACCTTGAACAGCCTTCCTGAACGAGCTCGGGTTCTTCTCG
TCTCTCTCGGCCTATTACTCAGTGGCTGTTTAATGATTTCCACCTGGCGT
TTCCCTGGATTAAAACACTTCCATTTTCGCGTTTCCTCATCGCTTTTAGT
TCTGGGAATCGGGTTAGTGGCTTGTCTCTTCTTCTCGGGACTAGTGGACC
ATTTCACACAAGTATTTTTCCTTGTCTCTTGGTTATACGTGCTAGTTGTT
GCTCCTGTTTTTTCCTTTATTAATAAAAGATCTTCTTCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy