Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR683 IGR680 IGR678 IGR682 IGR681 IGR684 IGR679 IGR685 ftsY, - CT820 CT819 sucD, - CT822 sucC, - CT821 tyrP, - CT818 tyrP, - CT817 htrA, - CT823 CT824 ftsY, - CT820 CT819 sucD, - CT822 sucC, - CT821 tyrP, - CT818 tyrP, - CT817 htrA, - CT823 CT824 ftsY, - CT820 CT819 sucD, - CT822 sucC, - CT821 tyrP, - CT818 tyrP, - CT817 htrA, - CT823 CT824
* Calculated from Protein Sequence

Gene ID: CT821

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
sucC  

Definition:
succinyl-CoA synthetase beta subunit

Gene Start:
964841

Gene Stop:
965998

Gene Length:
1158

Molecular Weight*:
41851

pI*:
5.48

Net Charge*:
-8.10

EC:
6.2.1.5  

Functional Class:
central intermediary metabolism; TCA cycle  

Pathway: pathway table
Carbohydrate Metabolism; Citrate cycle (TCA cycle)

Comment:
This enzyme in E.coli is a tetramer of two alpha and two beta chains. For the
alpha chain sequence, see CT822. The reaction adds CoA to succinate, with the beta subunit holding the attchment
sites for succinate.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to succinyl-CoA synthetase beta subunit chains, e.g.
residues 1-384 are 43% similar to the subunit from B.subtilis (Z99112).
Weaker similarties are to adhesins and to ATP-citrate lyases. Psi-BLAST
brings conserrved hypothetical proteins to significance. No similarities
to T.pallidum or M.genitalium.

CT821 is orthologously related to CPn0973:
residues 1-385 are 67% similar to that of CPn0973.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0045
COG name: Succinyl-CoA synthetase beta chain
Functional Class:  C
The phylogenetic pattern of COG0045 is Amt-yQ-cebrh------inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 55-357 are 43% similar to a succinyl CoA ligase domain as observed in SUCC_ECOLI.
Residues 44-357 are 25% similar to a citrate lyase domain seen in ACLY_RAT.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 31 to 198 (E-value = 2.5e-19) place CT821 in the ATP-grasp family which is described as ATP-grasp domain (PF02222)
Residues 246 to 382 (E-value = 3.7e-42) place CT821 in the Ligase_CoA family which is described as CoA-ligase (PF00549)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
94  
112
transmembrane  
257  
277
transmembrane  
311  
333

PDB Hit:
gi|1065086|pdb|1SCU|B Chain B, Succinyl-Coa Synthetase (Succinate-Coa Ligase) (Adp-Forming) (E.C.6.2.1.5)

Gene Protein Sequence:
MHLHEYQAKDLLTAYQLPIPPYHVATSVPEVETAIQAEQWKAGVVKAQVH
AGGRGKNGGVVIAHSPEDLLAAADKLLHMQFSSNQTAGLSLPINKVLISP
LVEIASEYYLAIVIDRKHRCPVIMLSKAGGVDIEEVAEKQPDQLLKMTLP
SSGKIYGYQLRRIAKFMEWDQPIADQGNRIIRQLLQCFYEKDASLLEINP
LVLTKDGSLVILDAKMTIDDNALYRHPQLADCYDPSQENIRDVLAKQLGL
SYIALDGTIGCLVNGAGLAMSTLDILKLYGGSAANFLDVGGSASEKQIQE
AISLVLSDKSVRVLFIHIFGGIMDCAVVASGLVSAMQGQKETIPTVIRLE
GTNVDKGKDMIINAGIPCEFVTSMSEGAELAVQLSR

Gene Nucleotide Sequence:  Sequence Viewer
ATGCATCTTCATGAGTATCAAGCTAAGGACCTTTTAACTGCTTATCAACT
TCCTATTCCCCCCTATCACGTAGCGACCTCCGTACCTGAAGTAGAAACAG
CGATTCAAGCCGAACAATGGAAAGCTGGTGTTGTGAAAGCACAGGTTCAT
GCTGGAGGAAGAGGAAAAAATGGAGGGGTGGTTATTGCGCACTCTCCGGA
AGACTTATTAGCAGCAGCTGATAAGCTACTGCATATGCAATTTTCTAGTA
ATCAGACAGCAGGGTTGTCTCTTCCTATTAATAAAGTATTGATTTCCCCT
TTAGTAGAGATTGCTTCGGAGTATTATCTTGCGATCGTCATCGATAGAAA
ACATCGTTGTCCTGTCATTATGCTATCTAAAGCAGGAGGTGTGGATATCG
AGGAAGTCGCAGAAAAGCAGCCGGATCAGCTGCTTAAAATGACACTACCT
TCTTCTGGAAAAATTTATGGGTATCAGTTACGCCGTATTGCTAAGTTCAT
GGAGTGGGATCAACCTATTGCCGATCAAGGGAATCGTATCATTCGCCAGT
TATTACAATGTTTTTATGAAAAGGATGCTTCTTTATTAGAGATTAATCCA
TTGGTACTTACTAAAGACGGGTCTCTTGTCATTCTAGATGCCAAAATGAC
GATTGATGACAATGCTCTTTATCGACATCCTCAGCTAGCAGACTGCTATG
ATCCTTCTCAGGAAAATATTCGTGACGTACTAGCTAAGCAGTTAGGCCTT
TCATACATTGCTCTAGATGGAACAATCGGATGTTTAGTCAATGGTGCAGG
ATTAGCGATGAGCACCTTAGATATTCTGAAGTTATATGGCGGTTCTGCTG
CCAATTTCTTAGATGTAGGAGGAAGTGCTTCTGAAAAGCAAATTCAAGAA
GCCATCTCTTTAGTCTTATCTGATAAAAGTGTGCGCGTGCTCTTTATCCA
TATTTTTGGGGGGATTATGGATTGTGCAGTCGTCGCTTCTGGACTTGTTT
CTGCTATGCAAGGACAGAAAGAAACGATCCCTACTGTAATTCGGTTAGAA
GGGACGAATGTAGATAAAGGAAAGGACATGATTATTAACGCAGGAATTCC
TTGTGAGTTCGTTACATCCATGAGCGAGGGGGCTGAACTCGCTGTGCAAT
TAAGTCGT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy