Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR677 IGR680 IGR678 IGR675 IGR681 IGR679 IGR676 IGR674 CT814 ftsY, - CT820 CT819 CT813 tyrP, - CT818 tyrP, - CT817 pmm,mrsA, - CT815 glmS, - CT816 pmpD, - CT812 CT814 ftsY, - CT820 CT819 CT813 tyrP, - CT818 tyrP, - CT817 pmm,mrsA, - CT815 glmS, - CT816 pmpD, - CT812 ftsY, - CT820 CT814.1 CT814 CT814.1 CT819 CT813 tyrP, - CT818 tyrP, - CT817 pmm,mrsA, - CT815 glmS, - CT816 pmpD, - CT812
* Calculated from Protein Sequence

Gene ID: CT816

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
glmS  

Definition:
glucosamine-fructose-6-phosphate aminotransferase

Gene Start:
958567

Gene Stop:
960384

Gene Length:
1818

Molecular Weight*:
67391

pI*:
5.55

Net Charge*:
-16.78

EC:
2.6.1.16  

Functional Class:
cell envelope; peptidoglycan  

Pathway: pathway table
Nucleotide Metabolism; Aminosugars metabolism

Comment:
This enzyme catalyzes the addition of glutamine to D-fructose-6-phosphate.
See CT629 for the glmU sequence.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to glucosamine-fructose-6-phosphate aminotransferase sequences,
e.g. residues 1-606 are 43% similar to GLMS_THETH.
Residues 1-606 are 35% similar to a predicted glucosamine-fructose-6-phosphate aminotransferase in
T.pallidum (TP0861). No similarity to M.genitalium.
CT816 is ortholgously related to CPn0968: residues 1-606 are 61% similar to CPn0968.

COGS Summary:  COGS Search
BeTs to 13 clades of COG0449
COG name: Glucosamine-fructose-6-phosphate aminotransferase, contains aminotransferase and phosphosugar isomerase domains
Functional Class:  M
The phylogenetic pattern of COG0449 is -MtkYqvcebrhuj---lin-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 24-33, 67-77, 96-112, 249-258, 590-605 are matched to blocks BL00443A-E, concerned with
glutamine aminotransferase sequences, e.g. GFA1_CANAL, GFA1_SCHPO, GLMS_THIFE, GLMS_THETH.

ProDom Summary:  Protein Domain Search
Residues 414-606 are 42% similar to a GLMS domain as seen in GLMS_THETH.
Residues 17-181, 296-395, 182-269 are also similar to GLMS domains.
Residues 245-442 are 22% similar to a domain of YHFN_ECOLI and residues
256-596 are 23% similar to a domain of AGAS_ECOLI.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 2 to 134 (E-value = 4.9e-56) place CT816 in the GATase_2 family which is described as Glutamine amidotransferases class-II (PF00310)
Residues 285 to 420 (E-value = 9.7e-30) place CT816 in the SIS family which is described as SIS domain (PF01380)
Residues 456 to 592 (E-value = 1.8e-15) place CT816 in the SIS family which is described as SIS domain (PF01380)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
364  
437

PDB Hit:
gi|1827657|pdb|1GMS|A Chain A, Glutaminase Domain Of Glucosamine 6-Phosphate Synthase Complexed With L-Glu Hydroxamate Glutamine Aminotransferase Mol_id: 1; Molecule: Glucosamine 6-Phosphate Synthase; Chain: A, C, E, G; Synonym: L-Glutamine:d-Fructose-6p

Gene Protein Sequence:
MCGIFGYLGEKNAVPLVLEGLSKLEYRGYDSAGIATLVEGRLFVEKAVGP
VSQLCSAVSSDIHSQAAIGHTRWATHGEPSRFNAHPHVDMDASCALVHNG
IIENFQKLKEELEEQGVVFSSDTDTEVIVQLFARRYKETRDLIQSFSWTL
KRLQGSFACALMHQDHPEVLLCAAHESPLILGLGEDEVFISSDIHAFLKY
SGCTQTLASGELAVLRIGKSIETYNFELARIQKEVRCIDHTEDSLDKKGF
DYYMLKELYEQPEVFERILHLTCEENGFTESFLKGFSLDEIQSLHIVACG
SSYHAGYLAKYVIESIASIPVYVETASEFRYRQPYIAEHSLAILISQSGE
TADTLAALNEFRKLSKARVLGICNVRESALASRVDHCLFIEAGLEVGVAS
TKAFTAQLLLLILLGLRLANHRQVIAQEDLAQAIQGLKDLPNLTRLFLDS
SIHDWRCRQIEETSFIFLGRRFMYPICMEAALKLKEIAYVEANAYPAGEM
KHGPIALIREGTPVIVYCGDRSVYTKTIGAIMEVKARKAYVIALAPESNR
DIAAVSDEQIYIPDSHDLAAPILFTIAGQIMAYTMALQRGTEVDRPRNLA
KSVTVE

Gene Nucleotide Sequence:  Sequence Viewer
ATGTGTGGGATATTTGGATATTTAGGAGAAAAGAACGCTGTACCTTTAGT
TTTGGAAGGGTTGTCTAAACTTGAGTATCGTGGTTATGACTCTGCAGGGA
TAGCAACTCTTGTTGAAGGCCGCTTGTTTGTAGAGAAGGCTGTAGGGCCT
GTAAGCCAGTTATGTTCTGCTGTTTCTTCTGATATCCATTCTCAGGCAGC
TATAGGCCATACGCGATGGGCTACACACGGAGAACCTTCCCGCTTTAATG
CACATCCTCATGTAGATATGGATGCGAGTTGTGCTTTGGTGCATAATGGA
ATTATTGAGAATTTCCAAAAACTCAAAGAAGAACTGGAAGAGCAGGGCGT
AGTATTTTCATCAGATACCGATACAGAGGTTATCGTACAACTTTTTGCAA
GGCGTTACAAAGAGACAAGAGATTTAATTCAAAGTTTTTCGTGGACTCTC
AAACGCTTACAGGGGAGTTTTGCTTGTGCTCTCATGCACCAAGATCATCC
TGAAGTTTTATTATGTGCTGCTCATGAAAGTCCTCTCATCCTAGGATTAG
GAGAAGATGAGGTTTTTATTTCTTCTGATATCCATGCTTTTTTAAAATAT
TCTGGCTGTACACAAACCTTGGCTTCAGGAGAACTAGCTGTTTTACGTAT
AGGGAAGTCTATCGAGACGTACAATTTTGAGTTAGCGCGTATCCAAAAGG
AAGTGCGTTGCATAGACCATACAGAAGATTCTTTGGATAAAAAAGGGTTT
GATTATTACATGCTCAAAGAGCTCTATGAGCAACCTGAAGTCTTTGAGCG
TATCTTACATCTCACGTGTGAAGAGAACGGTTTTACAGAATCTTTTTTAA
AAGGGTTCTCTTTGGACGAGATTCAGAGCTTGCATATTGTAGCTTGCGGC
TCTTCTTATCATGCCGGCTATTTAGCCAAATATGTGATTGAATCTATCGC
TTCCATTCCGGTATATGTAGAAACTGCTTCAGAGTTTCGTTATCGTCAGC
CATATATAGCAGAGCATTCGCTAGCTATTCTCATCAGTCAGTCAGGAGAA
ACGGCAGATACGTTAGCCGCTCTTAATGAGTTCCGCAAGTTGAGCAAAGC
ACGTGTTCTCGGGATTTGTAATGTACGAGAGTCCGCTCTTGCTTCTCGAG
TCGACCATTGTCTGTTTATTGAGGCGGGATTGGAAGTGGGAGTCGCTTCT
ACAAAGGCATTCACAGCTCAGCTGTTGCTGTTGATTCTTTTGGGTTTAAG
GCTAGCAAACCATCGCCAAGTCATTGCTCAGGAAGACTTAGCGCAAGCAA
TACAAGGTCTGAAAGATTTGCCAAATTTGACAAGACTTTTCTTAGATAGT
TCTATTCATGACTGGCGTTGCCGACAAATTGAGGAGACGAGTTTTATTTT
CCTAGGGCGACGTTTTATGTATCCAATTTGCATGGAAGCAGCTTTAAAAT
TAAAAGAAATTGCTTACGTAGAAGCAAATGCTTACCCTGCAGGAGAAATG
AAGCATGGGCCTATTGCTCTTATTAGAGAGGGGACTCCCGTGATTGTGTA
TTGTGGAGATCGCTCTGTATACACTAAAACTATAGGAGCGATCATGGAGG
TGAAGGCTAGAAAGGCCTATGTGATCGCTCTTGCTCCGGAATCCAATCGG
GATATCGCTGCTGTCTCCGACGAGCAGATCTATATCCCCGATAGCCACGA
CCTTGCTGCTCCTATCTTATTCACGATAGCAGGCCAGATCATGGCTTACA
CCATGGCTTTACAGAGAGGAACCGAAGTAGATAGACCTCGGAACTTGGCT
AAATCTGTTACTGTAGAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy