Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR669 IGR672 IGR668 IGR667 IGR673 IGR671 IGR666 IGR670 plsB, - CT807 CT805 rng,cafA, - CT808 ptr, - CT806 rl32, - CT810 CT809 plsX, - CT811 pmpD, - CT812 plsB, - CT807 CT805 rng,cafA, - CT808 ptr, - CT806 rl32, - CT810 CT809 plsX, - CT811 pmpD, - CT812 plsB, - CT807 CT805 rng,cafA, - CT808 ptr, - CT806 rl32, - CT810 CT809 plsX, - CT811 pmpD, - CT812
* Calculated from Protein Sequence

Gene ID: CT807

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
plsB  

Definition:
glycerol-3-phosphate-O-acyltransferase

Gene Start:
946462

Gene Stop:
945470

Gene Length:
993

Molecular Weight*:
37898

pI*:
6.06

Net Charge*:
-7.23

EC:
2.3.1.15  

Functional Class:
fatty acid and phospholipid metabolism  

Pathway: pathway table
Metabolism of Complex Lipids; Glycerolipid metabolism

Comment:
This enzyme is involved in the first step in phospholipid biosynthesis,
converting acyl-CoA and glycerol-3-phosphate to CoA and 1-acyl-glycerol-3-phosphate.
See CT453 and CT811.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to glycerol-3-phosphate-O-acyltransferase sequences,
e.g. residues 5-3-3 are 40% similar to the enzyme from Cucumis sativus (M80571).
BLAST matches are to plant proteins. No similarities to T.pallidum or M.genitalium.

COGS Summary:  COGS Search
No hit to the COGs database.


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 5-303 are 38% similar to a glycerol-3-phosphate acyltransferase domain
as observed in PLSB_CUCMO.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 97 to 259 (E-value = 8.8e-38) place CT807 in the Acyltransferase family which is described as Acyltransferase (PF01553)

PDB Hit:
none

Gene Protein Sequence:
MHFSNCLYQAFEDQLLPEPLYQKFQICYQTYIEAASKKCSAEKAEALCSQ
WLKVIIDDLKNPIIFPPYHKKIRSPIDLYQFGIDFFSALIDDQKSQILHP
ERLDQIQEYIQAGHNVVLLANHQTESDPQLMYCLLGASYPQLMESMIFVA
GDRITSDPLARPFSMGCDLLCIYSKRHINHPPELKEEKLMHNQKSMRTLK
MLLSEGGKFFYVAPSGGRDRKNLQGELYPAEFHPDSVEMFRLLAKSSGKT
THFFPLAMKTYDILPPPPTIEEAIGEHRVISFAPVAFNFGDELLLDELCS
SEEADIHDKHALRALRASRAFSIVTDLYKEI

Gene Nucleotide Sequence:  Sequence Viewer
ATGCATTTTTCAAACTGTTTATATCAGGCTTTTGAAGATCAGCTTTTACC
AGAGCCTTTGTACCAAAAGTTTCAAATTTGCTATCAAACCTACATCGAGG
CTGCATCTAAAAAATGCTCCGCTGAGAAAGCGGAAGCTCTTTGTTCTCAA
TGGCTTAAGGTCATTATTGATGACCTTAAGAATCCTATTATTTTCCCTCC
CTACCACAAAAAAATTCGCTCGCCAATTGATCTTTACCAATTTGGCATCG
ACTTTTTTTCTGCGCTGATTGACGACCAAAAATCACAAATTCTACATCCT
GAGCGATTGGATCAGATTCAAGAATATATCCAAGCTGGACACAACGTAGT
GCTGTTAGCTAACCACCAGACAGAATCAGACCCCCAGCTCATGTACTGCT
TACTCGGAGCCTCCTATCCGCAACTCATGGAAAGCATGATCTTTGTTGCA
GGGGATCGGATCACTTCAGATCCTCTAGCGCGACCTTTTAGCATGGGATG
CGATCTTCTGTGTATTTATTCAAAAAGACACATCAATCACCCTCCAGAAC
TGAAAGAAGAAAAGCTCATGCATAACCAAAAAAGCATGAGAACATTAAAA
ATGCTTCTTAGCGAAGGAGGGAAATTCTTTTATGTTGCTCCTTCCGGAGG
AAGAGATCGTAAAAATCTTCAAGGAGAATTGTACCCTGCAGAATTTCATC
CTGACAGTGTAGAGATGTTCCGCCTCCTTGCCAAAAGCTCCGGGAAAACG
ACTCATTTCTTCCCTTTAGCAATGAAAACCTATGATATTCTTCCTCCGCC
TCCGACAATAGAGGAAGCGATCGGAGAACATCGCGTGATCTCATTTGCCC
CCGTTGCTTTTAACTTTGGAGACGAACTGTTGCTCGATGAGCTTTGTTCT
TCCGAAGAAGCTGATATACATGATAAACACGCCCTACGTGCTTTAAGAGC
CTCTCGTGCCTTCTCTATCGTGACTGATCTCTACAAAGAAATC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy