Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR669 IGR663 IGR664 IGR668 IGR665 IGR667 IGR671 IGR666 IGR670 plsB, - CT807 CT805 rng,cafA, - CT808 ptr, - CT806 rs18, - CT802 CT809 rs6, - CT801 rl9, - CT803 CT804 plsB, - CT807 CT805 rng,cafA, - CT808 ptr, - CT806 rs18, - CT802 CT809 rs6, - CT801 rl9, - CT803 CT804 plsB, - CT807 CT805 rng,cafA, - CT808 ptr, - CT806 CT809 rs6, - CT801 rl9, - CT803 CT804 rs18, - CT802
* Calculated from Protein Sequence

Gene ID: CT806

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ptr  

Definition:
Insulinase family/Protease III

Gene Start:
945410

Gene Stop:
942543

Gene Length:
2868

Molecular Weight*:
108363

pI*:
4.95

Net Charge*:
-28.04

EC:
3.4.24.56  3.4.99.44  

Functional Class:
uncategorized  

Pathway: pathway table

Secondary Evidence:
Finch, P.W., R.E. Wilson, K. Brown, I.D. Hickson, P.T. Emmerson. 1986. "Complete nucleotide sequence of"Escherichia coli ptr gene encoding protease III." Nucleic Acids Res. 14:7695-7703
Dykstra, C., S.R. Kushner 1985. "Physical characterization of the cloned protease III gene from Escherichia coli K-12." J.Bacteriol. 163:1055-1059.
FRICKE B, BETZ R, FRIEBE S. 1995. "A PERIPLASMIC INSULIN-CLEAVING PROTEINASE (ICP) FROM ACINETOBACTER-CALCOACETICUS SHARING PROPERTIES WITH PROTEASE-III FROM ESCHERICHIA-COLI AND IDE FROM EUKARYOTES." JOURNAL OF BASIC MICROBIOLOGY 35(1): 21-31.

Comment:
Possible eukaryotic-like insulinase (ide).

Insulin degrading enzyme/protease III can cleave insulin and TGF-alpha and
usually degrades small peptides of less than 7 kD.
This protein requires divalent cations for activity and it binds zinc.
Insulin degrading enzyme/protease III is probably monmeric and
periplasm-associated and belongs to peptidase family M16 which is also known as
the insulinase family.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to eukaryotic insulin-degrading enzyme sequences, e.g.
residues 68-946 are 24% similar to the enzyme from Drosophila (M58465).
Residues 102-321 are 20% similar to a hypothetical protein from
T.pallidum (TP0025). Residues 58-248 are 22% similar to a putative zinc protease
from B.burgdorferi (AE001155). No similarity to M.genitalium.

CT806 is orthologously related to CPn0957: residues 25-953 of CT806 are 47%
similar to residues 9-941 of CPn0957, a predicted Insulinase family/protease III
from C. pneumoniae. This protein is similar to PG77, a predicted zinc protease from Porphyromonas gingivalis.

COGS Summary:  COGS Search
BeTs to 3 clades of COG1025
COG name: Secreted/periplasmic Zn-dependent peptidases, insulinase-like
Functional Class:  O
The phylogenetic pattern of COG1025 is ----Y---e---------in-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 87-115, 231-250, 834-853 are matched to blocks BL00143A,B, concerned with
insulinase sequences, e.g. YQA4_CAEEL, PQQL_ECOLI. Residues 612-623
and 783-795 are matched to blocks BL01288B,H, which encompass uncharacterized proteins,
e.g. RTCB_ECOLI.

ProDom Summary:  Protein Domain Search
Residues 83-216 are 42% similar to a protease domain as observed in IDE_DROME.
Residues 596-760 are 19% similar to a insulinase domain as observed in YQA4_CAEEL.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis. Residues 97-185 are
30% similar to a stretch of CT824, thought to be a metalloprotease (E value 0.001).

Pfam Summary:  Pfam Search
Residues 72 to 208 (E-value = 5.5e-26) place CT806 in the Peptidase_M16 family which is described as Insulinase (Peptidase family M16) (PF00675)
Residues 225 to 408 (E-value = 2.2e-24) place CT806 in the Peptidase_M16_C family which is described as Peptidase M16 inactive domain (PF05193)
Residues 700 to 879 (E-value = 6e-18) place CT806 in the Peptidase_M16_C family which is described as Peptidase M16 inactive domain (PF05193)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
675  
786

PDB Hit:
none

Gene Protein Sequence:
MDNHPPVINDPTNDPKNMKRSLSLLLLCIPSFLTACSKSFQTIRDENPLT
ILTPALADQKIAKILCPNGLSLMIVSSPHAAESGAALVVKTGNNADPVEF
PGLAHFTEHCVFLGNEKYPEPSGFPAFLSTHGGIYNAFTYPDKTCFLFSV
NNADLDNALDQFVHLFIQPLFRQEDLNKEVHAVEQEFAMHPTKDSRRMHR
IQQLIAPKNHPLKRFGCGNLSTLNSVTTQDMQTWFATHYSPENMAAIVYT
TAPLDTAVPYIASLFSEIPISAQYTPQKPFPKTQDTTALNKLFINKAVEP
SPQLAIYWHFYDAPQSLQGWAQSLISILSSEKENSLVALLKKEQLITEME
AELYSTSHNTQDFEILYKLTNKGEREYQRVLQLTFAFLDYVRHERLPAYS
LPEIQKINSLEYTYSTQTELFSTLSRMVPNFTSEPLATYPYRSLVYPEYS
QEDEQTFATFLADPQQARYILSATLPSSWENADEFYDPIFDDTFYEKPLD
FTPIQDSSSLGFAFPNPNKFIPQTVQLLSQKKQHEGFAFSPQLTYDQNAI
TLYTCEDSFYTIPKMAMELRIRSPQIQRTDVRSLVLRDLYSLLANETLIK
RYDDALKAGMTFAVSPGATGVDLSLLGYTETSPVLINALLSSLRDLPVEE
SLFLYYKDQLSEQYQKNLIACPIRAGLNKLYSQILVDTVSLEDKLNTLNT
LSYEEFANFTNKLLQELAVESLALGTLSAQDLSNLLSTLSNFAEASSPYA
APSYYPQRKPLSSTKLSFQYPLSGNGMLLLEQNEDPHQYKDSVATSMLLS
WIHNLYFSDLRTEQQLGYMVGSKYLEFAETPCGLFYIRSNNYSPEELVHR
TQLFIQKIATDPESAGLSEEIFEQLRETYIQSILLPSSTPLAMAKKLFSI
AFETKKQDFSRPDQKIAAARSMDYSYFKKYCEEFLSQKFGPEIQLLVYGA
NSSQEK

Gene Nucleotide Sequence:  Sequence Viewer
ATGGACAACCACCCTCCTGTTATCAATGACCCTACCAATGACCCCAAAAA
TATGAAGCGTTCCCTATCCCTATTACTTCTTTGCATTCCTTCTTTTCTAA
CTGCTTGCTCGAAATCCTTTCAAACGATTCGAGATGAAAATCCTTTGACT
ATTTTGACCCCTGCATTAGCAGATCAAAAAATTGCTAAAATTCTATGCCC
TAACGGACTCTCTCTCATGATTGTATCCTCCCCTCATGCTGCTGAGTCCG
GAGCCGCTTTAGTTGTCAAAACAGGAAATAATGCAGATCCTGTCGAGTTC
CCAGGCTTAGCCCATTTTACAGAACACTGTGTGTTCCTCGGGAATGAAAA
ATATCCCGAGCCCTCAGGATTTCCTGCCTTCCTAAGCACACATGGGGGTA
TCTATAACGCATTTACTTACCCAGATAAAACCTGCTTCCTATTCTCCGTA
AACAATGCAGATTTAGATAATGCTCTGGATCAGTTTGTACATCTCTTTAT
CCAACCTCTCTTCCGCCAAGAAGATTTAAACAAAGAAGTTCATGCTGTTG
AGCAAGAATTTGCGATGCATCCAACTAAAGATTCTCGTCGTATGCATCGT
ATTCAACAACTTATAGCTCCTAAAAATCACCCATTAAAACGCTTTGGCTG
CGGCAATCTCTCTACCCTCAACTCCGTCACTACTCAAGATATGCAAACAT
GGTTTGCCACTCACTACTCTCCAGAAAATATGGCAGCAATTGTTTACACT
ACAGCTCCGTTGGACACCGCAGTGCCGTATATCGCGTCCCTATTCTCTGA
AATCCCTATATCTGCACAGTACACACCACAAAAACCGTTTCCAAAGACAC
AGGATACTACTGCTCTTAATAAACTGTTCATCAATAAGGCTGTCGAACCT
TCTCCACAACTAGCTATTTACTGGCATTTTTATGATGCTCCACAGTCCTT
ACAAGGATGGGCTCAGTCACTGATTTCTATTTTATCTAGTGAAAAAGAAA
ATAGTCTTGTTGCTTTACTCAAAAAAGAACAGCTCATTACTGAGATGGAA
GCAGAACTTTACAGCACTTCTCATAATACACAAGATTTTGAAATTCTTTA
TAAACTCACCAATAAGGGGGAACGCGAATATCAAAGAGTTTTGCAGCTAA
CTTTTGCTTTTCTTGATTATGTTCGTCATGAACGACTTCCTGCCTACTCC
TTGCCAGAGATACAGAAAATCAACTCTTTAGAATATACTTACAGCACGCA
AACCGAGTTATTCTCGACACTATCACGAATGGTCCCCAATTTTACTTCTG
AACCATTAGCAACATACCCTTATCGCTCTCTTGTCTATCCAGAATACTCC
CAAGAAGATGAACAAACCTTTGCTACATTTTTAGCAGACCCTCAACAGGC
ACGTTATATCTTATCTGCTACCCTACCGAGTTCTTGGGAGAATGCAGATG
AATTCTATGATCCCATCTTTGACGACACTTTCTATGAAAAACCCTTAGAT
TTCACACCTATACAGGACTCCTCCTCCTTAGGATTTGCTTTTCCGAATCC
CAATAAATTTATTCCTCAAACAGTCCAATTATTATCTCAAAAGAAACAAC
ACGAAGGGTTTGCTTTTTCTCCGCAGCTGACCTATGATCAAAATGCGATC
ACTTTATATACTTGTGAAGACTCTTTCTATACGATTCCTAAAATGGCTAT
GGAGTTGCGCATCCGTTCTCCTCAAATTCAACGAACAGATGTGCGTTCTT
TAGTATTACGAGACCTATATAGTCTACTAGCTAATGAAACATTAATAAAA
CGTTATGACGATGCTTTAAAAGCTGGAATGACTTTTGCAGTATCTCCTGG
AGCGACAGGGGTTGATCTTTCTCTTTTAGGATATACTGAGACCTCTCCTG
TTCTTATCAATGCTTTGCTGTCTTCTTTACGAGATCTTCCTGTGGAAGAA
AGTCTGTTTCTATATTACAAAGATCAGCTATCAGAACAATATCAGAAGAA
TCTTATTGCCTGCCCTATAAGAGCTGGTCTCAATAAACTATACTCTCAGA
TTCTTGTTGATACCGTTTCCTTAGAAGATAAGCTCAATACTTTAAACACC
CTCTCCTACGAAGAGTTTGCGAACTTCACGAATAAACTACTCCAAGAACT
AGCTGTAGAATCTTTAGCACTAGGAACGCTCTCGGCTCAAGATCTCTCCA
ATTTATTATCGACTCTCTCTAACTTTGCAGAAGCTTCGTCTCCTTATGCT
GCTCCTAGCTATTATCCTCAAAGAAAACCTCTCTCTTCTACAAAGCTTTC
GTTCCAATATCCTCTCTCTGGAAATGGTATGCTGCTGCTCGAACAAAACG
AAGATCCCCATCAATATAAGGACTCTGTAGCTACTAGTATGTTGTTATCT
TGGATCCATAACTTGTACTTCTCTGATTTACGTACAGAGCAACAACTTGG
GTATATGGTAGGTTCTAAATATCTGGAATTCGCAGAAACTCCTTGTGGAC
TTTTCTATATTCGATCCAATAACTATTCTCCTGAGGAGCTTGTGCATAGA
ACACAACTCTTTATACAAAAGATTGCTACTGATCCAGAATCTGCAGGCTT
GTCCGAAGAGATCTTTGAACAGCTTCGAGAAACATATATCCAGTCCATAT
TGCTTCCAAGTTCCACACCTTTAGCTATGGCGAAAAAATTATTCTCTATA
GCTTTTGAAACGAAAAAACAGGATTTTTCTCGCCCAGACCAAAAAATAGC
TGCTGCCCGTTCTATGGATTACAGCTATTTCAAAAAGTACTGTGAAGAAT
TTTTGAGTCAAAAGTTTGGCCCAGAAATCCAACTCCTCGTCTATGGAGCC
AACTCGTCTCAGGAAAAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy