Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Gln-1 IGR661 IGR659 IGR663 IGR664 IGR665 IGR657 IGR662 IGR666 IGR658 IGR660 CT805 glgA, - CT798 glyQS, - CT796 rs18, - CT802 rs6, - CT801 CT795 rl9, - CT803 pth, - CT800 ctc, - CT799 pgsA, - CT797 CT804 CT805 glgA, - CT798 glyQS, - CT796 rs18, - CT802 rs6, - CT801 CT795 rl9, - CT803 pth, - CT800 ctc, - CT799 pgsA, - CT797 CT804 CT805 glgA, - CT798 glyQS, - CT796 rs6, - CT801 CT795 rl9, - CT803 pth, - CT800 ctc, - CT799 pgsA, - CT797 CT804 rs18, - CT802
* Calculated from Protein Sequence

Gene ID: CT798

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
glgA  

Definition:
glycogen synthase

Gene Start:
936833

Gene Stop:
935412

Gene Length:
1422

Molecular Weight*:
53359

pI*:
5.60

Net Charge*:
-12.64

EC:
2.4.1.11  2.4.1.21  

Functional Class:
energy metabolism; starch and sucrose metabolism  

Pathway: pathway table
Metabolism of Complex Carbohydrates; Starch and sucrose metabolism

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to glycogen synthase sequences, e.g. residues 127-473
are 34% similar to the enzyme from Synechocystis (D90899). Psi-BLAST
does not reveal any different relationships. NO similarities to T.pallidum
or M.genitalium.
CT798 is orthologously related to CPn0948: residues 1-473 are 53% similar to CPn0948.

COGS Summary:  COGS Search
BeTs to 8 clades of COG0297
COG name: Glycogen synthase
Functional Class:  G
The phylogenetic pattern of COG0297 is -m-k-qvCeb-h------in-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 142-154 are matched to block PR00211D, concerned with glutelin signature
sequences, e.g. in GLU2_MAIZE.

ProDom Summary:  Protein Domain Search
Residues 1-293 are 28% similar to a glycogen synthase domain as observed in
GLGA_ECOLI. Residues 382-404 are consistent with this relationship.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 282 to 457 (E-value = 3.2e-05) place CT798 in the Glycos_transf_1 family which is described as Glycosyl transferases group 1 (PF00534)

PDB Hit:
none

Gene Protein Sequence:
MKIIHTAIEFAPVIKAGGLGDALYGLAKALAANHTTEVVIPLYPKLFTLP
KEQDLCSIQKLSYFFAGEQEATAFSYFYEGIKVTLFKLDTQPELFENAET
IYTSDDAFRFCAFSAAAASYIQKEGANIVHLHDWHTGLVAGLLKQQPCSQ
LQKIVLTLHNFGYRGYTTREILEASSLNEFYISQYQLFRDPQTCVLLKGA
LYCSDFVTTVSPTYAKEILEDYSDYEIHDAITARQHHLRGILNGIDTTIW
GPETDPNLAKNYTKELFETPSIFFEAKAENKKALYERLGLSLEHSPCVCI
ISRIAEQKGPHFMKQAILHALENAYTLIIIGTCYGNQLHEEFANLQESLA
NSPDVRILLTYSDVLARQIFAAADMICIPSMFEPCGLTQMIGMRYGTVPL
VRATGGLADTVANGINGFSFFNPHDFYEFRNMLSEAVTTYRTNHDKWQHI
VRACLDFSSDLETAANKYLEIYKQ

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAATTATTCACACAGCTATCGAATTTGCTCCGGTAATCAAAGCCGG
AGGCCTGGGAGACGCGCTATACGGACTAGCAAAAGCTTTAGCCGCTAATC
ACACAACGGAAGTGGTAATCCCTTTATACCCTAAATTATTTACTTTGCCC
AAAGAACAAGATCTTTGCTCGATCCAAAAATTATCTTATTTTTTTGCTGG
AGAGCAAGAAGCAACTGCTTTCTCCTACTTTTATGAAGGAATTAAAGTAA
CTCTATTCAAACTCGACACACAGCCAGAGTTATTCGAGAATGCGGAAACA
ATCTACACAAGCGATGATGCCTTCCGTTTTTGCGCTTTTTCTGCTGCTGC
GGCCTCCTACATCCAAAAAGAAGGAGCCAATATCGTTCATTTACACGATT
GGCATACAGGATTAGTTGCTGGACTACTCAAACAACAGCCCTGCTCTCAA
TTACAAAAGATTGTTCTTACCCTACATAATTTTGGTTATCGAGGCTATAC
AACACGAGAAATATTAGAAGCCTCCTCTTTGAATGAATTTTATATCAGCC
AGTACCAACTATTTCGCGATCCACAAACTTGTGTGTTGCTAAAAGGAGCT
TTATACTGTTCAGATTTCGTGACTACGGTTTCTCCTACATACGCCAAAGA
AATTCTTGAAGATTATTCCGATTACGAAATTCACGATGCCATTACTGCTA
GACAACATCATCTCCGCGGGATTTTAAATGGAATCGACACGACAATTTGG
GGGCCTGAAACGGATCCCAATTTAGCGAAAAACTACACTAAAGAGCTTTT
CGAGACCCCTTCAATTTTTTTTGAAGCTAAAGCCGAGAATAAAAAAGCCT
TGTACGAAAGATTAGGCCTCTCTTTAGAACACTCTCCTTGCGTGTGCATT
ATTTCTAGAATTGCTGAGCAGAAAGGTCCTCACTTTATGAAACAGGCCAT
TCTCCATGCACTAGAAAACGCTTACACGCTCATTATTATAGGTACCTGCT
ACGGGAATCAATTGCATGAAGAATTTGCAAATCTTCAAGAATCATTAGCG
AATTCCCCTGATGTAAGGATTCTTTTGACTTATAGTGATGTGCTGGCACG
ACAAATTTTCGCCGCTGCAGATATGATCTGCATTCCTTCTATGTTTGAAC
CATGTGGACTCACACAAATGATTGGAATGCGTTACGGGACTGTACCGTTA
GTAAGAGCTACAGGAGGACTAGCAGATACTGTAGCAAATGGAATCAATGG
ATTTTCCTTCTTTAATCCGCATGACTTCTATGAATTCCGAAACATGCTTT
CGGAAGCAGTGACAACCTACCGTACCAACCACGACAAGTGGCAACATATT
GTACGTGCTTGTCTAGATTTTTCTTCAGACCTAGAAACTGCCGCCAATAA
ATATTTAGAAATTTATAAACAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy