Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Gln-1 IGR661 IGR659 IGR663 IGR664 IGR665 IGR657 IGR655 IGR656 IGR662 IGR658 IGR660 glgA, - CT798 glyQS, - CT796 rs18, - CT802 CT794.1 rs6, - CT801 CT795 rl9, - CT803 pth, - CT800 ctc, - CT799 pgsA, - CT797 CT804 dnaE/G,priM, - CT794 glgA, - CT798 glyQS, - CT796 rs18, - CT802 CT794.1 rs6, - CT801 CT795 rl9, - CT803 pth, - CT800 ctc, - CT799 pgsA, - CT797 CT804 dnaE/G,priM, - CT794 glgA, - CT798 glyQS, - CT796 rs6, - CT801 CT795 pth, - CT800 ctc, - CT799 pgsA, - CT797 CT804 dnaE/G,priM, - CT794 rs18, - CT802 CT794.1 rl9, - CT803
* Calculated from Protein Sequence

Gene ID: CT797

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
pgsA  

Definition:
phosphatidylglycerophosphate synthase

Gene Start:
934794

Gene Stop:
935399

Gene Length:
606

Molecular Weight*:
22738

pI*:
8.78

Net Charge*:
3.08

EC:
2.7.8.5  

Functional Class:
fatty acid and phospholipid metabolism  

Pathway: pathway table
Metabolism of Complex Lipids; Glycerolipid metabolism

Comment:
PGSA (phosphatidylglycerophosphate synthase, or CDP-diacyglycerol-
glycerol -3-phosphate) is an integral membrane protein involved
in synthesis of acidic phospholipids. CDP-diacylglycerol-glycerol-3-phosphate
is converted to 3-(3-phosphatidyl)-glycerol 1-phosphate.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to PGSA sequences, e.g. residues 4-195
are 31% similar to PGSA_BACSU. Psi-BLAST identifies
phosphatidylserine synthase and phosphatidylinositol synthase
sequences in addition to PGSA sequences. Residues 8-47 are 42% similar
to the M.genitalium sequence MG114 (U39695). Residues 133-171 are weakly similar
to a stretch of outer membrane protein 2 from trachomatis (M23001). CT797
is also similar to TP0256 of T.pallidum.

CT797 is orthologous to CPn0947: residues 3-201 are 68% similar to CPn0947.
CT797 is weaklysimilar to CPn0615.

COGS Summary:  COGS Search
BeTs to 15 clades of COG0558
COG name: Phosphatidylglycerophosphate synthase
Functional Class:  I
The phylogenetic pattern of COG0558 is A-tKYQvcEbRhujgpOLINx
Number of proteins in this genome belonging to this COG is 2


Blocks Summary:  Blocks Search
Residues 52-88 are significantly matched to block BL00379,
which includes PGSA sequences, e.g. PGSA_BACSU.

ProDom Summary:  Protein Domain Search
Residues 44-79 are 58% similar to a PGSA domain as observed
in PGSA_BACSU. Residues 96-137 are also connected to a
PGSA domain in PGSA_BACSU. Residues 45-79 show some similarity to
a phosphatidylserine synthase domain, in PSS_METJA.

Paralogs:  Local Blast Search
CT797 is paralogously related to CT496, also a phosphatidylglycerophosphate
synthase sequence: residues 42-148 are 29% similar to CT496.

Pfam Summary:  Pfam Search
Residues 42 to 186 (E-value = 1.2e-32) place CT797 in the CDP-OH_P_transf family which is described as CDP-alcohol phosphatidyltransferase (PF01066)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
32  
53
transmembrane  
92  
113
transmembrane  
132  
157
transmembrane  
162  
184

PDB Hit:
none

Gene Protein Sequence:
MRVSLPNFLTVFRLFITPIFMILYLKGRWFGLSAAFLPYVLLFLLIITEI
TDAVDGYIARKFSQVTDLGKLLDPMADSVYRISLYLTFTQPPVNLPLILV
FIFLARDSVISTLRTLCASRGQVLAARMSGKLKAILQAISFFFIIFSMFL
CAKGIISTDDLEFFSTVIVSLVAFYSICSGVEYIWVNKSHLLQKNDSPDG
ES

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGAGTGAGCTTACCAAACTTCCTGACAGTTTTTCGTCTATTTATCAC
ACCGATTTTTATGATTCTTTACTTAAAAGGTCGGTGGTTCGGGTTGTCTG
CCGCATTCCTGCCTTATGTTCTCCTCTTTTTGCTGATCATTACGGAAATC
ACGGATGCTGTAGATGGATATATTGCGAGAAAGTTTTCCCAGGTAACAGA
TCTGGGAAAACTTCTAGATCCCATGGCTGATAGTGTATACCGTATTTCGC
TGTACCTCACGTTCACACAACCTCCCGTGAATCTTCCTCTCATACTTGTG
TTTATTTTCTTAGCTCGAGATTCCGTTATTAGCACTTTGCGTACGCTATG
CGCTAGTAGGGGACAAGTATTAGCTGCTAGGATGAGTGGGAAGTTAAAAG
CTATTCTTCAAGCTATTAGCTTCTTTTTCATCATTTTCTCGATGTTCCTT
TGTGCAAAAGGCATTATCTCCACAGACGATTTAGAGTTTTTCTCAACAGT
GATAGTGTCTTTAGTAGCCTTTTATTCTATTTGCTCTGGAGTTGAGTATA
TTTGGGTGAATAAAAGTCACTTATTACAGAAAAATGACTCGCCGGATGGC
GAGTCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy