Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR653 IGR654 IGR657 IGR655 IGR656 IGR658 uvrC, - CT791 mutS, - CT792 glyQS, - CT796 CT793 CT794.1 CT795 dnaE/G,priM, - CT794 uvrC, - CT791 mutS, - CT792 glyQS, - CT796 CT793 CT794.1 CT795 dnaE/G,priM, - CT794 uvrC, - CT791 mutS, - CT792 glyQS, - CT796 CT793 CT795 dnaE/G,priM, - CT794 CT794.1
* Calculated from Protein Sequence

Gene ID: CT794

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
dnaE/G  priM  

Definition:
DNA primase

Gene Start:
928463

Gene Stop:
930247

Gene Length:
1785

Molecular Weight*:
68029

pI*:
7.86

Net Charge*:
6.54

EC:
2.7.7.-  

Functional Class:
DNA replication and repair  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Ubiquinone biosynthesis

Secondary Evidence:
Wang,L.F., Price,C.W. and Doi,R.H. 1985. Bacillus subtilis dnaE encodes a protein homologous to DNA primase of Escherichia coli. J. Biol. Chem. 260 (6): 3368-3372. Medline: 85131129.

Smiley,B.L., Lupski,J.R., Svec,P.S., McMacken,R. and Godson,G.N. 1982. Sequences of the Escherichia coli dnaG primase gene and regulation of its expression. Proc. Natl. Acad. Sci. U.S.A. 79 (15), 4550-4554. Medline: 83014926.

Comment:
This is a polymerase that synthesizes short RNA primers for replication forks. In
B.subtilis it is a monomer.
See CT250, CT275, CT341, CT396, CT075, CT334, CT187.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to DNA primase sequences e.g. residues 5-590 are 27% similar to PRIM_BACSU.
Residues 8-500 are 26% similar to the DNA primase sequence from T.pallidum (TP0492).
Psi-BLAST brings forward other DNA primase/helicase sequences as well as some hypothetical proteins.
CT794 is also similar to MG250 of M.genitalium.

CT794 is orthologusly related to CPn0942, a predicted DNA Primase: residues 3-594
are 55% similar to CPn0942.

COGS Summary:  COGS Search
BeTs to 15 clades of COG0358
COG name: DNA primase (bacterial type)
Functional Class:  L
The phylogenetic pattern of COG0358 is amtk-qvcebrhujGPolinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 25-322 are 37% similar to a DNA primase domain as seen in PRIM_BACSU.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 3 to 100 (E-value = 3.6e-62) place CT794 in the zf-CHC2 family which is described as CHC2 zinc finger (PF01807)
Residues 251 to 331 (E-value = 5.8e-17) place CT794 in the Toprim family which is described as Toprim domain (PF01751)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
405  
476

PDB Hit:
none

Gene Protein Sequence:
MYYTEESLETLKHSIDIVSVLGEYVHLKRSGADYKACCPFHDEKTPSFIV
YPTRGHYHCYGCGEHGDAINFLMKQQGYSFSEAVLFLAKKFHVDLVVRTK
ETSGQDSKDSLRRINREAERFFQYCLLHLPEGEEALAYLYKRGFSPDTID
RFQIGYAPEQRLFIQAMEERNISVKQLEWAGYLAKDWFLFAQRIMFPIQD
ALGYTIGFSSRRFKEGGRGGKYINSPETILFKKSRVLYGLQFSRKRIAKE
RRVILVEGQADCLQMIDFGFNCTLAAQGTSFTETHVHELVKLGVSKAYLL
FDGDAAGEKASLRVGDLCQAAGITAIVCRLPSGQDPDSFLMQRGPEELRE
LLDRGEDYLSFLVWHKIHSYEQFTPREKARVIEEVIQQVRCWGSPITIHE
YLRQLASLVKVPEPAVLSYLSSITSAAEDKGKKVSAKEPSSESKQTSTEG
KISKKISPRMILEADVIRCLLFAKPEDEFVPATVKQYLSPEEFHCAEYRA
IFVMAMNHYNDRQTLPSMDEMMSLVVGTEAMTLLVARRMNTELMRDIVVQ
SIQKLLDKHWRDKKRKLCHQTGKGLDSLQEYVRLSGERVKVSLVS

Gene Nucleotide Sequence:  Sequence Viewer
ATGTATTACACAGAAGAGAGCTTAGAGACTCTAAAACATAGTATTGATAT
TGTTAGCGTTTTGGGGGAATACGTACATTTAAAGCGCAGCGGTGCAGATT
ACAAGGCTTGCTGTCCTTTTCATGATGAGAAAACACCGTCATTTATCGTG
TACCCAACTAGAGGCCACTACCATTGTTATGGATGTGGAGAGCATGGTGA
TGCCATTAATTTTCTTATGAAACAGCAGGGATATTCTTTCTCTGAAGCGG
TACTTTTCTTAGCGAAAAAGTTTCATGTTGATCTTGTTGTCAGAACTAAA
GAGACCTCAGGGCAAGATTCTAAAGATAGTCTTCGGCGTATTAACAGAGA
AGCTGAAAGGTTTTTTCAATACTGTTTATTACATTTGCCGGAAGGGGAAG
AGGCTTTAGCCTATTTATATAAGCGAGGGTTTTCTCCCGATACGATAGAT
CGTTTTCAGATTGGTTATGCTCCTGAGCAAAGATTGTTTATTCAAGCGAT
GGAAGAGCGCAATATTTCTGTGAAGCAGCTAGAGTGGGCTGGGTATCTCG
CTAAAGACTGGTTTTTGTTTGCTCAGAGAATCATGTTCCCGATTCAAGAT
GCTTTAGGCTATACCATTGGATTTTCTTCTCGGAGGTTCAAAGAAGGTGG
GCGTGGTGGAAAATATATTAATTCCCCGGAGACCATTTTATTTAAAAAAT
CTCGGGTATTATACGGGTTACAATTTTCTCGTAAGCGCATCGCTAAAGAG
CGGAGAGTGATTTTAGTTGAAGGTCAGGCAGATTGTTTGCAAATGATTGA
TTTTGGCTTCAACTGTACTTTGGCTGCTCAAGGGACTTCTTTCACAGAGA
CTCATGTGCATGAGTTAGTTAAATTAGGAGTATCAAAAGCTTATTTATTA
TTTGATGGGGATGCTGCTGGAGAAAAAGCATCGTTACGTGTTGGGGATCT
TTGTCAGGCTGCAGGGATTACTGCTATAGTCTGTCGGCTTCCTTCTGGGC
AAGATCCGGATTCTTTTTTAATGCAACGAGGGCCTGAAGAGTTACGAGAG
CTTCTCGATAGAGGAGAGGATTATCTTTCCTTTCTAGTTTGGCACAAGAT
TCATTCTTATGAACAGTTTACTCCAAGAGAAAAAGCTCGAGTAATCGAAG
AGGTAATTCAACAGGTGCGTTGTTGGGGAAGTCCTATTACCATTCATGAG
TACTTGAGGCAGTTGGCTTCTTTGGTCAAGGTTCCAGAACCTGCTGTTTT
GAGCTATCTTTCTTCCATTACGTCTGCTGCTGAAGACAAAGGGAAAAAGG
TCTCCGCAAAAGAACCTTCCTCAGAGTCTAAGCAAACTTCTACAGAAGGA
AAAATTTCAAAAAAAATTTCTCCGAGGATGATTTTAGAAGCTGACGTGAT
ACGGTGTTTGTTATTTGCTAAGCCCGAAGATGAGTTTGTCCCCGCAACGG
TAAAGCAGTATCTTTCTCCGGAAGAGTTTCATTGTGCAGAATATCGAGCT
ATATTTGTTATGGCTATGAATCACTACAATGATCGGCAAACACTGCCCTC
TATGGACGAGATGATGTCTTTAGTTGTTGGTACTGAAGCAATGACTCTTC
TTGTTGCCAGACGGATGAATACCGAACTTATGAGAGACATTGTTGTTCAA
TCGATTCAGAAATTATTGGACAAACATTGGCGAGACAAAAAGCGTAAGCT
ATGTCATCAGACGGGTAAAGGTTTAGATTCTTTACAAGAGTATGTTCGTC
TTTCCGGAGAGAGAGTTAAGGTTTCTTTAGTTTCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy