Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR643 IGR646 IGR648 IGR653 IGR649 IGR652 IGR645 IGR650 IGR642 IGR644 IGR651 IGR647 rl34, - CT785 CT789 rnpA, - CT784 CT788 cysS, - CT782 uvrC, - CT791 mutS, - CT792 rl36, - CT786 rs14, - CT787 CT780 CT790 CT783 lysS, - CT781 rl34, - CT785 CT789 rnpA, - CT784 CT788 cysS, - CT782 uvrC, - CT791 mutS, - CT792 rl36, - CT786 rs14, - CT787 CT780 CT790 CT783 lysS, - CT781 rnpA, - CT784 CT788 cysS, - CT782 uvrC, - CT791 mutS, - CT792 rl34, - CT785 CT789 rs14, - CT787 CT780 CT790 CT783 lysS, - CT781 rl36, - CT786
* Calculated from Protein Sequence

Gene ID: CT784

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
rnpA  

Definition:
ribonuclease P protein component

Gene Start:
921028

Gene Stop:
920669

Gene Length:
360

Molecular Weight*:
13814

pI*:
12.24

Net Charge*:
21.51

EC:
3.1.26.5  

Functional Class:
translation; tRNA modification  

Pathway: pathway table

Comment:
RNAse P cleaves the 5' ends of tRNAs thereby leading to tRNA maturation.
It consists of an RNA component (with catalytic site ) and a protein component.
The RNA coding region needs to be identified.

From Prosite PDOC00558:

Ribonuclease P (EC 3.1.26.5) (RNase P) is a site specific endonuclease that generates mature tRNAs by cleaving-off the leader sequences at their 5'ends. In bacteria RNase P is known to be composed of two components: a large (about 400 base pairs) RNA (gene rnpB) and a small protein (119 to 133 amino acids) (gene rnpA). The RNA moiety of RNase P carries the catalytic activity; the function of the protein component is not yet clear although it may act as an electrostatic screen allowing the highly negatively charged RNA enzyme-substrate complex to fold into the catalytic conformation.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to RNPA sequences, e.g. residues 1-104 are 36% similar to RNPA_ECOLI.
CT784 is weakly similar to a predicted ribonuclease P sequence from B.burgdorferi (AE001149):
residues 8-74 are 27% similar to this protein. Psi-BLAST favors alignment to
more distant RNAse P sequences. No similarities to T.pallidum. MG465 is the predicted
RNAse P protein that is weakly similar to CT784.

CT784 is orthologously related to CPn0934: residues 4-122 of CT784
are 57% similar to residues 4-123 of CPn0934, ribonuclease P protein
component from C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0594
COG name: RNase P protein component
Functional Class:  L
The phylogenetic pattern of COG0594 is ------vcebrhujgpo-inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 6-27, 51-88, 53-74 are matched to blocks BL00648A,B, concerned with
ribonuclease P sequences, e.g. RNPA_STRBI, RNPA_BACSU.

ProDom Summary:  Protein Domain Search
Residues 12-70 are 35% similar to an RNAse P domain as observed in RNPA_BACSU.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 6 to 112 (E-value = 1.9e-13) place CT784 in the Ribonuclease_P family which is described as Ribonuclease P (PF00825)

PDB Hit:
none

Gene Protein Sequence:
MSRLTLPKNARLLKRKQFVYVQRNGRCCRADQVTLRVVPSRHSNTRKVGI
TVSKKFGKAHQRNRFKRIVREAFRHVRPNLPGCQVVISPRGNSQPDFLKL
SEELLQRIPEALPLASSSRC

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTCGGTTAACTTTACCTAAGAATGCTCGTTTACTGAAACGTAAACA
ATTTGTTTATGTTCAGAGGAATGGACGTTGTTGTCGTGCCGATCAAGTGA
CTTTACGGGTCGTTCCCTCTCGTCATTCGAACACCCGTAAAGTAGGAATT
ACTGTGTCAAAGAAATTTGGAAAAGCTCATCAACGCAATCGTTTTAAGCG
GATCGTGCGAGAGGCTTTTAGACATGTACGCCCAAATCTTCCGGGTTGTC
AGGTGGTTATTTCTCCGAGAGGAAATTCGCAGCCAGATTTTTTGAAACTA
TCGGAAGAACTTCTTCAACGCATACCTGAGGCTTTGCCCCTCGCCTCTTC
ATCCAGATGC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy