Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR639 IGR640 IGR641 IGR642 IGR638 CT774 priA, - CT778 CT780 CT775 ldh,dhlE, - CT773 bioF, - CT777 lysS, - CT781 aas, - CT776 CT774 priA, - CT778 CT780 CT775 ldh,dhlE, - CT773 bioF, - CT777 lysS, - CT781 aas, - CT776 CT774 priA, - CT778 CT779 CT779 CT780 CT775 ldh,dhlE, - CT773 bioF, - CT777 lysS, - CT781 aas, - CT776
* Calculated from Protein Sequence

Gene ID: CT777

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
bioF  

Definition:
8-amino-7-oxononanoate synthase

Gene Start:
911375

Gene Stop:
912505

Gene Length:
1131

Molecular Weight*:
41439

pI*:
6.51

Net Charge*:
-3.90

EC:
2.3.1.47  

Functional Class:
cofactor biosynthesis; biotin and lipoic acid  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Biotin metabolism

Comment:
In H.influenzae, the BIOF enzyme catalyzes the addition
of L-alanine to 6-carboxyhexanoyl-CoA as part of the biotin
biosynthesis pathway. See CT359 for the bioY sequence.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to 8-amino-7-oxononanoate synthase sequences,
e.g. residues 11-194 are 32% similar to the enzyme from B.subtilis (Z99119).
Psi-BLAST reveals more similarities to aminolevulinate synthase sequences.
No similarities to T.pallidum or M.genitalium.

CT777 is orthologusly related to CPn0923: residues 7-344 are 49% similar to
CPn0923.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0156
COG name: Biotin biosynthesis protein BioF and related aminotransferases
Functional Class:  H
The phylogenetic pattern of COG0156 is -m-kYq-cEBRhuj----iNx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 11-19, 20-29, 37-49, 46-84, 123-132, 146-158, 180-192, 210-219 are
matched to blocks BL00599A-G, concerned with aminotransferase class II sequences,
e.g. BIOF_MYCLE, HEMO_CHICK.

ProDom Summary:  Protein Domain Search
Residues 44-183 are 34% similar to an aminolevulinate synthase domain as observed
in BIOF_BACSU.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 43 to 348 (E-value = 1.3e-05) place CT777 in the Aminotran_1_2 family which is described as Aminotransferase class I and II (PF00155)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
74  
97
transmembrane  
200  
216

PDB Hit:
none

Gene Protein Sequence:
MKEALSIDFITNDFLGFSRSDSLVHAVEARYRLYCRDKPHAQLGYGGSRA
ILGSSSLLDGVEHQIAHFHGAPEALILPSGFVANTAICAHLSSVADYVLW
DEQVHISVSYNLSVFLSGWHQSFRHNDLDHLESLLESCQQRGFQRVFILV
CSVYSFKGSFALLEQIVALSHQYHAQLIVDEAHAVGLFGDAGKGFCASLG
YENFYSVLVTFSKALGSAGAAWLSSRDRKQDLIKEPMVSLSTGIPPYLLV
SIQVAYEFLSQEGELARTRLRRIRDYFAQKISWAAAGFVQPLSLPGISEQ
ELYQKLVATGIRVGVACPPTGKVLRANLHAFNTEQEVDILVSLLATEQVT
YQKNVVTGSTSTMQRTLEDNFAAANAS

Gene Nucleotide Sequence:  Sequence Viewer
TTGAAGGAAGCTCTTTCTATTGATTTTATCACTAATGATTTCCTGGGATT
CTCTCGTTCAGATAGCTTAGTTCATGCTGTTGAGGCTCGTTATCGGCTTT
ATTGTAGAGACAAGCCTCATGCGCAGTTAGGTTATGGAGGTTCGCGCGCT
ATTTTAGGCTCTTCCTCGCTGTTAGATGGGGTAGAGCATCAAATAGCGCA
CTTTCATGGAGCTCCAGAAGCTCTTATTTTGCCAAGTGGTTTTGTTGCGA
ATACTGCGATTTGTGCGCATCTATCTTCCGTAGCGGATTATGTGCTATGG
GACGAGCAGGTGCATATCTCCGTTTCTTACAATCTATCTGTTTTTTTGTC
GGGGTGGCATCAGAGTTTCCGCCATAATGATTTAGATCATCTAGAGTCTT
TATTAGAGTCTTGTCAGCAACGTGGTTTTCAACGAGTATTTATCCTCGTC
TGTTCTGTTTATTCTTTTAAGGGGTCTTTTGCTCTTTTGGAGCAAATAGT
GGCATTGTCTCATCAGTATCACGCTCAGTTGATAGTTGATGAAGCGCATG
CTGTGGGATTATTTGGAGACGCTGGGAAGGGATTTTGTGCCTCGTTAGGG
TATGAAAATTTCTATTCTGTACTCGTTACCTTCAGTAAAGCTTTGGGATC
CGCGGGTGCAGCTTGGTTATCTTCTCGCGATAGGAAGCAGGATTTGATCA
AAGAACCTATGGTAAGTCTTTCTACAGGAATACCTCCCTATTTGTTAGTA
TCTATACAAGTTGCATACGAATTTCTCTCACAAGAAGGAGAACTTGCGAG
AACACGATTACGTCGTATTCGTGACTATTTTGCTCAAAAAATCTCTTGGG
CAGCAGCTGGATTTGTGCAACCGCTCTCTCTCCCTGGGATCTCTGAGCAG
GAATTGTATCAAAAATTAGTTGCCACAGGCATTCGTGTTGGAGTCGCTTG
TCCTCCTACAGGTAAAGTACTGCGAGCCAATTTACATGCTTTCAATACCG
AACAAGAAGTAGATATTTTGGTTTCGTTGCTTGCCACGGAGCAAGTAACG
TATCAGAAGAATGTCGTAACAGGATCTACATCAACAATGCAACGCACTTT
AGAGGACAATTTTGCAGCGGCTAATGCCTCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy