Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR639 IGR635 IGR640 IGR636 IGR637 IGR638 IGR634 ipyR, - CT772 CT774 priA, - CT778 CT769 CT771 CT775 ldh,dhlE, - CT773 bioF, - CT777 fabF, - CT770 aas, - CT776 ipyR, - CT772 CT774 priA, - CT778 CT769 CT771 CT775 ldh,dhlE, - CT773 bioF, - CT777 fabF, - CT770 aas, - CT776 ipyR, - CT772 CT774 priA, - CT778 CT769 CT771 CT775 ldh,dhlE, - CT773 bioF, - CT777 fabF, - CT770 aas, - CT776
* Calculated from Protein Sequence

Gene ID: CT774

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
3'(2'),5'-bisphosphate nucleotidase

Gene Start:
908651

Gene Stop:
907626

Gene Length:
1026

Molecular Weight*:
38784

pI*:
7.41

Net Charge*:
2.95

EC:
3.1.3.7  

Functional Class:
uncategorized  

Pathway: pathway table
Sulfur metabolism

Comment:
Possible CysQ (cysQ) sulfite synthesis protein.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to 3'(2'), 5'-biphosphate nucleotidase sequences
e.g. residues 11-283 are 28% similar to the enzyme from A.thaliana
(Z83312). Other hits (in Psi-BLAST) are to HAL2-like proteins, ammonium transport
proteins and hypothetical proteins. No similarities to T.pallidum or M.genitalium.
CT774 is orthologously related to CPn0920: residues 1-311 are 49% similar to CPn0920.

COGS Summary:  COGS Search
BeTs to 5 clades of COG1218
COG name: 3'-Phosphoadenosine 5'-phosphosulfate (PAPS) 3'-phosphatase
Functional Class:  P
The phylogenetic pattern of COG1218 is ----yq-ce-rh------in-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 42-72, 117-133, 256-270 are matched to blocks BL00629A,B,E, concerned with
inositol-monophosphatase family sequences, e.g. CYSQ_ECOLI.

ProDom Summary:  Protein Domain Search
Residues 89-310 are 25% similar to a halotolerance protein domain seen in HAL2_YEAST.
Residues 44-72 and 95-154 are consistent with this relationships
as evidenced by similarities to CYSQ_ACTAC and CYSQ_HAEIN.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 4 to 320 (E-value = 1.9e-67) place CT774 in the Inositol_P family which is described as Inositol monophosphatase family (PF00459)

PDB Hit:
gi|996146|pdb|1IMA|A Homo sapiens

Gene Protein Sequence:
MFSLLNDCQKAAETVVMQAMLSLMRYRKAHKFIPFWKKPDQTYVTPADYA
IQYYFYQKLTSLFPHIPLVGEETLNPATDHPRIPQILQFAQQLDPKVSCQ
DLYQALSPESSHSSLFWLTDPIDGTSGFIKQRCFAIALSLFYEHTPVLSV
IACPSSENNSFKIYSAAKGEGLTICNPTHSFPFSLHEDFQPTCKFCEASL
SARNHQHLTTHILSKHLPWNPQPIRADSQCKYAWVADNTVDFFIRIPYSP
PRAHYRDHAPGVFLIEEAGGLVTDISGNPLPFSNPNLYLDRHPLILASAN
EQMHSTILETLYKLRHQATQNMLPLATHISATKHKQLSALQL

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTCTCCCTCCTCAATGACTGCCAAAAAGCTGCGGAAACAGTTGTCAT
GCAGGCTATGCTGTCACTGATGCGCTATCGAAAAGCTCATAAATTTATTC
CCTTTTGGAAAAAGCCTGACCAGACATACGTTACTCCCGCTGATTACGCT
ATCCAATATTATTTTTACCAAAAACTGACATCTTTATTTCCGCATATCCC
GCTGGTCGGAGAAGAAACTCTCAATCCTGCCACGGATCACCCTAGGATCC
CTCAAATCCTACAATTTGCGCAGCAGCTCGATCCCAAAGTCTCCTGTCAA
GATTTGTATCAGGCCCTCTCTCCGGAAAGCTCCCACTCTTCACTATTTTG
GTTAACGGACCCTATCGACGGTACTTCGGGATTCATCAAACAACGTTGTT
TCGCCATCGCTCTTTCTCTATTTTACGAACATACTCCTGTTCTCTCCGTT
ATCGCTTGCCCTTCTTCTGAAAATAACTCTTTCAAAATCTATTCGGCAGC
CAAAGGCGAAGGACTTACGATTTGTAATCCTACCCATTCCTTCCCCTTCT
CCCTGCACGAAGATTTCCAACCTACCTGTAAATTCTGTGAAGCCTCCTTA
TCAGCTAGAAACCATCAACATTTAACTACACATATTCTCAGTAAACATCT
CCCTTGGAATCCTCAGCCTATCCGAGCAGATAGTCAATGCAAATACGCTT
GGGTTGCAGATAATACGGTAGACTTCTTCATTCGCATCCCGTATTCCCCT
CCACGAGCCCACTACAGAGACCATGCTCCCGGTGTGTTTCTTATAGAAGA
AGCTGGAGGCCTCGTTACAGATATATCGGGGAATCCTCTCCCTTTTTCTA
ATCCAAATTTATATCTAGATAGACATCCTTTGATTCTTGCTTCTGCTAAC
GAGCAAATGCATAGCACGATTTTAGAGACTCTATACAAACTACGTCACCA
AGCTACTCAAAACATGCTCCCCCTTGCCACTCATATCTCTGCTACTAAGC
ATAAACAGCTAAGCGCTCTTCAACTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy