Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR639 IGR635 IGR640 IGR636 IGR637 IGR638 IGR634 ipyR, - CT772 CT774 CT769 CT771 CT775 ldh,dhlE, - CT773 bioF, - CT777 fabF, - CT770 aas, - CT776 CT768 ipyR, - CT772 CT774 CT769 CT771 CT775 ldh,dhlE, - CT773 bioF, - CT777 fabF, - CT770 aas, - CT776 CT768 ipyR, - CT772 CT774 CT769 CT771 CT775 ldh,dhlE, - CT773 bioF, - CT777 fabF, - CT770 aas, - CT776 CT768
* Calculated from Protein Sequence

Gene ID: CT773

DNA Molecule Name:
1  

Genbank ID:
3329236

Gene Name:
ldh  dhlE  

Definition:
leucine dehydrogenase (glutamate dehydrogenase?)

Gene Start:
906617

Gene Stop:
907654

Gene Length:
1038

Molecular Weight*:
37237

pI*:
5.08

Net Charge*:
-7.40

EC:
1.4.1.9  

Functional Class:
amino acid biosynthesis; valine, leucine, isoleucine  

Pathway: pathway table
Valine, leucine and isoleucine biosynthesis
Valine, leucine and isoleucine degradation

Comment:


Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to leucine dehydrogenase sequences, e.g.
residues 15-342 are 41% similar to the enzyme from T.intermedius (S45607). Other hits are to valine, phenylalanine and glutamate dehydrogenases. No similarities to T.pallidum or M.genitalium.

CT773 is orthologously related to CPn0919: residues 1-345 of CT773 are 57% similar to residues 1-349 of CPn0919, a predicted leucine dehydrogenase (glutamate dehydrogenase?) from C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 6 clades of COG0334
COG name: Glutamate dehydrogenase/leucine dehydrogenase
Functional Class:  E
The phylogenetic pattern of COG0334 is a--kY-vceBrhuj----inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 174-192 and 175-190 are matched to blocks PR00370A,D,
concerned with flavin-containing monooxygenase (FMO) signatures.

ProDom Summary:  Protein Domain Search
Residues 35-263 are 45% similar to a glutamate dehydrogenase domain as observed in DHLE_BACST. Residues 281-295 support this relationship.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 15 to 138 (E-value = 1.9e-13) place CT773 in the GLFV_dehydrog_N family which is described as Glu/Leu/Phe/Val dehydrogenase, dimerisation domain (PF02812)
Residues 144 to 341 (E-value = 2.2e-13) place CT773 in the GLFV_dehydrog family which is described as Glutamate/Leucine/Phenylalanine/Valine dehydrogenase (PF00208)

PDB Hit:
gi|1942796|pdb|1LEH|A Chain A, Leucine Dehydrogenase From Bacillus sphaericus Oxidoreductase Mol_id: 1; Molecule: Leucine Dehydrogenase; Chain: A, B; Ec: 1.4.1.9; Biological_unit: Octamer

Gene Protein Sequence:
MKYSLQIEDLHIEGYEQVLKVTCESVQLVAVIAIHQTKVGPALGGIRAFP
YLQFEDGLQDALRLSKAMTYKALLSSTETGGGKSVIFLPKGMTSPTEGML
RAFGQAVNSLQGKYIAAEDVGVSVQDVMIIREETPYVCGLVTVSGDPSIY
TAHGVFLCIQETADYLCKTDIRGKRVAVQGLGAVGRKLVHELFFAGAELI
VYDTRKDLLDEVVTLYGAQVDENIISADCDILCPCALGGIINSMSIDQLR
CRAIVGATNNQLENPAIGRELVARGILYAPDYLANAGGLLNVAGSVGRAY
SPKEVLSKVEGLPKILRKLYEQGAKENRDTGTLADAIVEERLAVYA

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATACTCTTTGCAAATAGAAGACCTACATATTGAAGGATATGAACA
GGTTTTGAAAGTTACTTGCGAGTCTGTACAGTTAGTTGCTGTAATTGCTA
TTCATCAGACAAAAGTCGGTCCAGCTTTAGGAGGCATTCGTGCCTTCCCT
TATCTTCAATTTGAGGATGGTTTACAAGATGCTCTACGTTTGTCAAAAGC
AATGACATACAAAGCTCTTCTCAGCAGTACAGAAACCGGAGGCGGGAAGA
GTGTCATTTTCTTGCCAAAAGGGATGACTAGTCCTACAGAAGGAATGCTG
CGAGCTTTTGGGCAAGCTGTAAACTCTTTACAAGGGAAGTACATTGCAGC
CGAGGATGTGGGGGTCTCTGTTCAGGATGTCATGATTATTCGTGAAGAGA
CACCGTATGTTTGTGGTCTTGTAACAGTCAGTGGAGACCCTTCTATTTAC
ACAGCTCACGGCGTGTTTTTATGTATTCAAGAAACTGCAGATTACCTTTG
TAAAACGGATATACGAGGAAAACGTGTCGCTGTACAAGGGTTAGGAGCAG
TCGGACGTAAGTTGGTGCATGAACTGTTCTTTGCCGGTGCAGAGTTAATC
GTTTACGACACAAGGAAAGATCTTCTCGATGAAGTAGTGACTTTATATGG
CGCCCAAGTGGATGAAAATATCATCTCTGCGGATTGCGATATTCTATGCC
CATGTGCCTTAGGTGGAATTATTAATTCGATGAGTATCGATCAGCTGCGA
TGTCGCGCTATTGTTGGAGCAACCAACAATCAATTAGAAAATCCTGCTAT
AGGCAGAGAATTGGTTGCTAGAGGGATTCTTTATGCTCCAGACTATCTTG
CTAACGCAGGAGGCTTATTGAATGTCGCTGGTTCCGTAGGGCGAGCTTAT
TCGCCTAAAGAAGTGTTAAGCAAGGTGGAAGGCCTGCCGAAAATACTTCG
TAAATTATACGAACAAGGGGCTAAAGAAAACCGAGACACAGGGACGTTGG
CTGATGCTATAGTTGAAGAGCGCTTAGCTGTTTATGCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy