Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR639 IGR635 IGR636 IGR633 IGR637 IGR638 IGR634 ipyR, - CT772 CT774 CT767 CT769 CT771 CT775 ldh,dhlE, - CT773 fabF, - CT770 aas, - CT776 CT768 ipyR, - CT772 CT774 CT767 CT769 CT771 CT775 ldh,dhlE, - CT773 fabF, - CT770 aas, - CT776 CT768 ipyR, - CT772 CT774 CT767 CT769 CT771 CT775 ldh,dhlE, - CT773 fabF, - CT770 aas, - CT776 CT768
* Calculated from Protein Sequence

Gene ID: CT772

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
ipyR  

Definition:
inorganic pyrophosphatase (PPASE)

Gene Start:
906369

Gene Stop:
905743

Gene Length:
627

Molecular Weight*:
23375

pI*:
4.59

Net Charge*:
-11.41

EC:
3.6.1.1  

Functional Class:
central intermediary metabolism; phosphorus compounds  

Pathway: pathway table
Energy Metabolism; Oxidative phosphorylation

Comment:
From Prosite PDOC00325:

Inorganic pyrophosphatase (EC 3.6.1.1) (PPase) is the enzyme responsible for the hydrolysis of pyrophosphate (PPi) which is formed principally as the product of the many biosynthetic reactions that utilize ATP. All known PPases require the presence of divalent metal cations, with magnesium conferring the highest activity. Among other residues, a lysine has been postulated to be part or close to the active site. PPases have been sequenced from bacteria such as Escherichia coli (homohexamer), thermophilic bacteria PS-3 and Thermus thermophilus, from the archaebacteria Thermoplasma acidophilum, from fungi (homodimer), from a plant, and from bovine retina. In yeast, a mitochondrial isoform of PPase has been characterized which seems to be involved in energy production and whose activity is stimulated by uncouplers of ATP synthesis.

The sequences of PPases share some regions of similarities. As signature patterns we have selected a region that contains three conserved aspartates that are involved in the binding of cations.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to inorganic pyrophosphatase sequences, especially to
plant enzymes, e.g. residues 9-168 are 36% similar to IPYR_SOLTU.
Residues 21-204 are 32% similar to IPYR_HELPY. Psi-BLAST
produces more distant relationships to PPASEs. CT772 is similar to MG351,
a predicted inorganic pyrophosphatease in M.genitalium. No similarity to
T.pallidum.
CT772 is orthologously related to CPn0918: residues 1-204 are 81% similar to CPn0918.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0221
COG name: Inorganic pyrophosphatase
Functional Class:  C
The phylogenetic pattern of COG0221 is --tkYq-ce-rhujgp--inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 28-40, 60-70, 92-101, 109-140, 141-168 are matched to
blocks BL00387A-E, concerned with inorganic pyrophosphatase sequences,
e.g. in IPYR_SOLTU, IPYR_BACP3, IPYR_ARATH.

ProDom Summary:  Protein Domain Search
Residues 92-151 are 42% similar to a PPASE domain as observed in IPYR_SULAC.
Residues 27-70 support this finding.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 27 to 206 (E-value = 5.2e-16) place CT772 in the Pyrophosphatase family which is described as Inorganic pyrophosphatase (PF00719)

PDB Hit:
gi|1311189|pdb|2PRD| Mol_id: 1; Molecule: Pyrophosphate Phosphohydrolase; Chain: Null; Ec: 3.6.1.1

Gene Protein Sequence:
MSKTPLSIAHPWHGPVLTRDDYESLCCYIEITPADSVKFELDKETGILKV
DRPQKFSNFCPCLYGLLPKTYCGDLSGEYSGQQSNRENIKGDGDPLDICV
LTEKNITQGNILLQARPIGGIRILDSEEADDKIIAVLEDDLVYGNIEDIS
ECPGTVLDMIQHYFLTYKATPESLIQAKPAKIEIVGLYGKKEAQKVIRLA
HEDYCNLFM

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCTAAAACACCATTATCCATAGCTCATCCTTGGCATGGGCCAGTATT
AACACGCGATGATTATGAATCTCTTTGTTGCTATATAGAAATCACTCCAG
CCGACTCCGTTAAATTCGAACTGGATAAAGAAACTGGTATCCTAAAAGTG
GATCGGCCACAAAAGTTTTCTAACTTTTGTCCTTGCTTATACGGGCTGTT
ACCTAAGACTTATTGTGGAGATCTTTCTGGAGAATACAGTGGTCAACAAA
GTAACAGAGAGAATATCAAAGGCGATGGCGATCCTCTTGATATCTGTGTG
TTAACGGAAAAAAATATTACACAAGGGAATATCCTCTTGCAAGCGCGTCC
TATCGGAGGGATTCGTATTTTAGACTCGGAAGAAGCCGATGATAAAATCA
TCGCTGTTCTAGAAGATGATTTAGTCTATGGCAATATAGAAGATATTTCT
GAATGCCCAGGCACAGTTTTGGACATGATCCAACACTATTTCTTAACCTA
TAAAGCTACTCCAGAAAGCTTAATTCAAGCAAAACCAGCTAAAATTGAAA
TTGTAGGTTTATACGGCAAAAAAGAAGCTCAAAAAGTCATTCGTCTTGCT
CACGAAGACTATTGCAATCTTTTTATG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy