Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR639 IGR635 IGR636 IGR633 IGR637 IGR638 IGR634 ipyR, - CT772 CT774 CT767 CT769 CT771 CT775 ldh,dhlE, - CT773 fabF, - CT770 aas, - CT776 CT768 ipyR, - CT772 CT774 CT767 CT769 CT771 CT775 ldh,dhlE, - CT773 fabF, - CT770 aas, - CT776 CT768 ipyR, - CT772 CT774 CT767 CT769 CT771 CT775 ldh,dhlE, - CT773 fabF, - CT770 aas, - CT776 CT768
* Calculated from Protein Sequence

Gene ID: CT771

DNA Molecule Name:
1  

Genbank ID:


Gene Name:


Definition:
conserved hypothetical protein (acidic)(possible Mut-family pyrophosphorylase)

Gene Start:
905207

Gene Stop:
905656

Gene Length:
450

Molecular Weight*:
17343

pI*:
4.91

Net Charge*:
-7.93

EC:
3.6.1.17  

Functional Class:
unknown  

Pathway: pathway table
Nucleotide Metabolism; Pyrimidine metabolism

Comment:
In eukaryotes, the AP4A hydrolase hydrolyzes AP4A to yield AMP and ATP.
(EC 3.6.1.17).

Blast Summary:  PSI-Blast Search
A few weak matches in gapped BLAST to eukaryotic bis (5' nucleosyl)-tetraphosphatase sequences
and to hypothetical proteins. Residues 22-145 are 33% similar to AP4A_MOUSE. Residues 2-143 are
28% similar to an unknown protein from M.tuberculosis (Z94121). Psi-BLAST brings to the forefront
additional hypothetical proteins as well as mutT proteins. No similarities to
T.pallidum or M.genitalium.

CT771 is orthologously related to CPn0917: residues 1-150 of CT771 are 77%
similar to residues 1-150 of CPn0917. a predicted conserved hypothetical protein
(acidic)(possible Mut-family pyrophosphorylase) from C. pneumoniae.



COGS Summary:  COGS Search
BeTs to 10 clades of COG0494
COG name: NTP pyrophosphohydrolases (MutT family) including oxidative damage repair enzymes
Functional Class:  L,R
The phylogenetic pattern of COG0494 is a-T-YqvCEBRHuj---linx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 42-66 are matched to block BL00893, concerned with mutT domain
proteins, e.g. INVA_BARBA.

ProDom Summary:  Protein Domain Search
Residues 37-75 are 48% similar to an invasion A protein from INVABARBA.
Residues 2-135 are also similar to a domain of a hypothetical protein,
as observed in YRFE_ECOLI.

Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis. Residues 23-40 are 50%
similar to a stretch of CT612, thought to be a dihydrofolate reductase.

Pfam Summary:  Pfam Search
Residues 6 to 144 (E-value = 3.3e-24) place CT771 in the NUDIX family which is described as NUDIX domain (PF00293)

PDB Hit:
none

Gene Protein Sequence:
MMKTKHEYSFGVIPIRFFGTPDRSTLKACFVCHTDGKHWGFPKGHAEEKE
GPQEAAERELVEETGLGIVNFFPKIFVENYSFNDKEEIFVRKEVTYFLAE
VKGEVHADPDEICDVQWLSFQEGLRLLIFPEIRNIVTEADKFVQSYLFAS


Gene Nucleotide Sequence:  Sequence Viewer
ATGATGAAAACTAAGCACGAATATTCTTTTGGCGTTATTCCTATCAGATT
TTTTGGTACTCCGGATAGAAGTACCTTAAAGGCTTGTTTTGTCTGCCATA
CAGATGGGAAACATTGGGGTTTCCCTAAGGGGCATGCTGAGGAAAAAGAA
GGCCCTCAGGAAGCTGCTGAGAGAGAACTTGTAGAAGAAACTGGTTTGGG
GATTGTTAATTTTTTCCCAAAAATATTTGTGGAAAATTATTCCTTTAATG
ACAAAGAAGAAATCTTTGTGCGTAAAGAGGTAACTTATTTTCTTGCAGAG
GTTAAAGGCGAAGTACATGCTGATCCTGATGAGATCTGTGATGTGCAGTG
GCTAAGCTTTCAAGAAGGTTTACGCCTTTTAATTTTCCCAGAAATTCGTA
ATATTGTTACGGAAGCAGATAAATTTGTTCAAAGTTATCTATTTGCTTCA



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy