Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR631 IGR627 IGR632 IGR635 IGR628 IGR633 IGR630 IGR629 IGR634 CT763 CT764 CT767 rsbV, - CT765 CT769 miaA, - CT766 murG, - CT761 fabF, - CT770 CT768 murC,murF, - CT762 CT763 CT764 CT767 rsbV, - CT765 CT769 miaA, - CT766 murG, - CT761 fabF, - CT770 CT768 murC,murF, - CT762 CT763 CT764 CT767 rsbV, - CT765 CT769 miaA, - CT766 murG, - CT761 fabF, - CT770 CT768 murC,murF, - CT762
* Calculated from Protein Sequence

Gene ID: CT766

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
miaA  

Definition:
tRNA isopentenylpyrophosphate transferase (IPP transferase)

Gene Start:
899276

Gene Stop:
900292

Gene Length:
1017

Molecular Weight*:
38063

pI*:
7.74

Net Charge*:
2.66

EC:
2.5.1.8  

Functional Class:
translation; tRNA modification  

Pathway: pathway table

Secondary Evidence:
Connolly,D.M. and Winkler,M.E. 1991. Structure of Escherichia coli K-12 miaA and characterization of the mutator phenotype caused by miaA insertion mutations. J. Bacteriol. 173(5): 1711-1721. Medline: 91154127.

Connolly,D.M. and Winkler,M.E. 1989. Genetic and physiological relationships among the miaA gene, 2-methylthio-N6-(delta 2-isopentenyl)-adenosine tRNA modification, and spontaneous mutagenesis in Escherichia coli K-12. J. Bacteriol. 171(6): 3233-3246. Medline: 89255089.

Comment:
In H. influenzae, this enzyme catalyzes the first step in the biosynthesis
of the isopentenyl-modified adenine adjacent to the anticodon of several tRNA species.

tRNA isopentenylpyrophosphate transferase catalyzes the first step
in the biosynthesis of
2-methylthio-N6-(delta(2)-isopentenyl)-adenosine (MS[2]I[6]A])
adjacent to the anticodon of several tRNA species.
Reaction: isopentenyl diphosphate + tRNA = pyrophosphate
+ tRNA containing 6-isopentenyladenosine. Specific tRNA
undermodification may be a switch to higher mutation frequency when
cells are subject to environmental stresses other than treatment
with mutagens.
Potential homodimer. tRNA isopentenylpyrophosphate transferase is
induced by 2-aminopurine.

Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to tRNA delta-2-isopentenylpyrophosphate
transferase sequences, e.g. residues 31-335 are 34% similar to AE000721 from
A. aeolicus.

CT766 is similar to TP0637 in T. pallidum, a predicted tRNA delta(2)-isopentenylpyrophosphate transferase. CT766 is orthologously related to CPn0910: residues 15-337 of CT766 are 66% similar to residues 18-340 of CPn0910, a tRNA isopentenylpyrophosphate transferase (IPP transferase) from C. pneumoniae. This protein is also similar to PG310, a predicted tRNA isopentenylpyrophosphate transferase (IPPtransferase) from Porphyromonas gingivalis. No similarity to M. genitalium.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0324
COG name: tRNA delta(2)-isopentenylpyrophosphate transferase
Functional Class:  J
The phylogenetic pattern of COG0324 is ----yqvcebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 52-61 are matched to block BL00697C, concerned with ATP-dependent DNA ligase,
AMP-binding site proteins, e.g. DNLI_DESAM.

ProDom Summary:  Protein Domain Search
Residues 32-135 are 43% similar to an IPP transferase domain observed
in MIAA_ECOLI. Residues 142-198, 226-333, 226-272 are supportive of this
relationship.

Paralogs:  Local Blast Search
No strong evidence of paralogs in C.trachomatis. Residues
14-71 are 35% similar to a stretch of CT705, a ClpX-like ATPase protease.
Residues 20-61 are 44% similar to a stretch of CT689, an ABC transporter ATPase.

Pfam Summary:  Pfam Search
Residues 63 to 320 (E-value = 2.7e-71) place CT766 in the IPPT family which is described as IPP transferase (PF01715)

Structural Feature(s):
Feature Type  Start  Stop
gram negative signal  
1  
9

PDB Hit:
None.

Gene Protein Sequence:
MSSSSSSGAATGFAVCSDPQKSFSKMFKRTVILLAGPTGSGKTAVSLKLA
PLVDGEIISVDSMQVYQGMDIGTAKVSLTDRKEVPHHLIDVCHVQESFNA
VDFYYHAVQACQDILSRNKVPILVGGTGFYFHTFLSGPPSGPSPDFVLRE
QLTLEAQERGISALYQELELLDPVYAATITKHDKNKIIRALEIIRKTGSK
VSSYAWQSTVNESKEYHCRRWLLSPDPELLRHNILERCDQMLEEGLLDEV
QALLAAGIKGNSSASRAIGYREWIEFLDLGSPPDLFEITKQKFITNTWRY
TKKQRTWFKRYSLFRELRPMGMTLDDMAKKIAQDYFLCG

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCCTCATCATCCTCTTCGGGAGCTGCAACTGGATTCGCTGTATGTTC
GGATCCGCAAAAATCTTTTTCAAAAATGTTTAAGCGGACAGTGATTCTGT
TGGCTGGGCCAACAGGATCTGGTAAAACAGCGGTTTCTCTTAAATTGGCG
CCTCTTGTGGACGGAGAGATTATCTCCGTAGATTCTATGCAGGTGTATCA
GGGAATGGATATTGGAACAGCAAAAGTTTCCCTAACAGACCGTAAGGAGG
TTCCGCATCACTTGATAGATGTGTGTCATGTCCAAGAGTCTTTTAATGCT
GTTGATTTCTATTATCATGCAGTGCAGGCATGTCAAGATATCTTGTCGCG
TAATAAAGTCCCCATTCTCGTAGGAGGGACAGGTTTTTATTTCCATACTT
TTCTATCAGGTCCGCCATCTGGGCCTTCTCCAGATTTTGTATTGCGGGAG
CAGCTTACATTAGAAGCGCAGGAACGAGGAATAAGCGCTCTATATCAAGA
ATTAGAGCTTTTGGATCCTGTTTATGCAGCCACTATTACCAAGCATGATA
AGAATAAAATTATTCGTGCTTTAGAAATTATTCGAAAAACGGGGAGTAAG
GTATCTAGTTATGCCTGGCAATCTACCGTAAATGAATCAAAAGAGTATCA
TTGTCGGAGGTGGCTTTTATCTCCAGATCCAGAGTTATTGCGCCATAATA
TTTTAGAACGATGTGATCAGATGTTAGAAGAAGGGCTTTTAGACGAGGTG
CAGGCTCTTTTAGCTGCTGGGATCAAAGGGAATTCTTCCGCATCACGAGC
AATTGGATACAGAGAATGGATAGAGTTCTTGGATTTAGGAAGCCCACCAG
ACTTATTTGAGATCACGAAGCAAAAATTTATTACCAATACGTGGCGTTAT
ACTAAGAAACAGCGTACCTGGTTTAAGAGGTATTCTTTGTTTAGAGAGCT
TAGGCCCATGGGGATGACTCTGGATGATATGGCAAAGAAGATAGCGCAAG
ACTATTTTCTTTGTGGG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy