Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Cys-1 IGR627 IGR625 IGR626 IGR624 IGR623 CT755 CT759 mraY, - CT757 ftsW, - CT760 murD, - CT758 murF, - CT756 murC,murF, - CT762 CT755 CT759 mraY, - CT757 ftsW, - CT760 murD, - CT758 murF, - CT756 murC,murF, - CT762 CT755 CT759 mraY, - CT757 ftsW, - CT760 murD, - CT758 murF, - CT756 murC,murF, - CT762 murG, - CT761 murG, - CT761
* Calculated from Protein Sequence

Gene ID: CT758

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
murD  

Definition:
N-acetylymuramoyl-L-alanine-D-glutamate ligase

Gene Start:
890826

Gene Stop:
892073

Gene Length:
1248

Molecular Weight*:
46101

pI*:
5.39

Net Charge*:
-9.99

EC:
6.3.2.9  

Functional Class:
cell envelope; peptidoglycan  

Pathway: pathway table
Metabolism of Complex Carbohydrates; Peptideglycan biosynthesis

Comment:
This enzymes catalyzes the addition of D-glutamate to
N-acetylmuramoylalanyl chains in cell wall biosynthesis.
L-alanine has been added by the AMIB enzyme (see CT268),
diaminopimelate will be added by the MURE protein (see CT269),
and D-alanine-D-alanine will be finally added by the MURF
protein. See CT756 and also CT757, CT759, CT760, CT761, and CT762.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to N-acetylymuramoyl-L-alanine-D-glutamate
ligase sequences, e.g., residues 4-411 are approximately 29%
similar to MURD_BACSU. CT758 is similar to TP0903 in T.pallidum.
No similarity to M.genitalium.
CT758 is orthologously related to CPn0901: residues 4-409 are 50% similar to CPn0901.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0771
COG name: UDP-N-acetylmuramoylalanine-D-glutamate ligase
Functional Class:  M
The phylogenetic pattern of COG0771 is --T--qvcebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Significant match of residues 4-22, 102-220 and 313-331 to
blocks PR00370A,D,E, which encompass flavin-containing
monooxygenase (FMO) signatures in eukaryotes. See also
blocks PR00757. These localized matches could be due to
low-information residues.

ProDom Summary:  Protein Domain Search
Residues 62-207 are 29% similar to an MURD domain of ECOLI.
Also, residues 365-405 are found in a domain of MURD_BACSU.

Paralogs:  Local Blast Search
CT758 is paralogously related to CT269, a UDP-N-acetylmuramoylalanyl-D-glutamate 2,6-diaminopimelate ligase: residues 19-196 are appoximately 25% similar to CT269.
Residues 5-29 are 48% similar to a stretch of CT592.

Pfam Summary:  Pfam Search
Residues 32 to 331 (E-value = 2.1e-05) place CT758 in the Mur_ligase family which is described as Mur ligase family, catalytic domain (PF01225)
Residues 276 to 353 (E-value = 1.1e-12) place CT758 in the Mur_ligase_C family which is described as Mur ligase family, glutamate ligase domain (PF02875)

PDB Hit:
gi|2981818|pdb|1UAG| Udp-N-Acetylmuramoyl-L-Alanine:d-Glutamate Ligase Ligase, Peptidoglycan Synthesis, Murd, Adp-Forming Enzyme Mol_id: 1; Molecule: Udp-N-Acetylmuramoyl-L-Alanine:D-Glutamate Ligase; Chain: Null; Synonym: Murd; Ec: 6.3.2.9; Engineered:

Gene Protein Sequence:
MGLERVVVIGLGVSGRSIAHFLAQKGVCVLGVDKSLHALQNCPYIQEKYL
ENEEFPSQVDYVVRSPGVSKEHPWVQAAIASHIPVMADIQLAFQTEKFTE
RESLAITGTTGKTTTILFLEYLFKRSGIPAFAMGNVGIPILDGMQNPGVR
IVEISSFQLADQEKSYPVLSGGMILNISDNHLDYHGNFSEYFQAKQNLAL
CMRNPDDLWVGDERFYGHLYLEEVQKYMRLLDKESALKPLYLHDKYNYCC
AYLLAKTEFPISETSFIEAVATFNKPPHRMEYLGQKQGIHYINDSKATTV
SATETALLGVGNQAIVILGGRNKGCTFSSLLPALRKAAKSVVAMGECAQE
IARDLEEFPVTVVKNLSEALLCAEEQAVPGDVIVLSPACASFDQFRSYEE
RGAMFKQLVGMEEVLL

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGATTGGAGCGTGTTGTCGTTATCGGCCTAGGTGTCTCTGGGAGGTC
TATTGCGCATTTTCTAGCTCAAAAAGGTGTATGTGTATTGGGTGTAGACA
AGTCGCTTCATGCACTTCAGAATTGCCCGTATATTCAGGAAAAATATTTG
GAGAACGAAGAGTTCCCTTCACAGGTGGATTATGTTGTTCGTTCTCCAGG
AGTATCCAAGGAGCATCCTTGGGTACAGGCTGCGATAGCCTCGCACATTC
CTGTCATGGCAGATATTCAGTTAGCTTTTCAAACAGAAAAATTTACAGAA
AGAGAGTCGTTAGCAATCACAGGGACTACAGGTAAGACAACCACAATATT
ATTTTTAGAATACTTATTCAAACGGTCTGGGATTCCTGCTTTCGCTATGG
GGAATGTAGGAATTCCTATTTTAGATGGTATGCAGAATCCTGGAGTGCGG
ATTGTTGAAATCAGCTCTTTCCAGCTCGCTGATCAAGAAAAATCCTATCC
TGTCTTATCTGGAGGAATGATTCTAAATATCTCAGATAACCATTTAGATT
ATCATGGGAATTTCTCTGAGTATTTTCAAGCCAAGCAAAATCTTGCTTTA
TGTATGCGTAATCCCGATGACCTTTGGGTAGGAGATGAGCGTTTTTACGG
CCACTTGTATTTAGAAGAAGTACAGAAGTATATGCGTTTATTAGATAAAG
AAAGTGCATTAAAACCATTGTACTTGCATGATAAGTACAACTACTGTTGT
GCCTATCTGCTTGCTAAAACAGAATTCCCAATATCCGAAACTAGCTTTAT
AGAAGCTGTGGCTACTTTTAACAAGCCTCCTCACAGGATGGAATATTTGG
GGCAAAAGCAAGGCATACATTATATCAATGATAGTAAGGCAACCACGGTG
AGTGCTACAGAAACAGCTCTTTTAGGGGTTGGGAATCAGGCAATTGTGAT
TCTTGGAGGAAGAAATAAGGGATGCACGTTCTCTTCGCTTCTTCCCGCTT
TGCGAAAAGCTGCGAAGAGTGTAGTCGCTATGGGAGAGTGCGCTCAGGAG
ATCGCTCGAGATCTAGAAGAGTTCCCTGTAACCGTAGTGAAAAATTTATC
TGAGGCTTTACTATGTGCTGAAGAGCAAGCAGTGCCTGGAGATGTGATTG
TATTGTCTCCGGCTTGTGCTAGCTTTGATCAATTCCGTAGCTATGAAGAG
CGAGGGGCAATGTTTAAGCAGTTGGTTGGGATGGAAGAGGTTCTTTTA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy