Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Cys-1 IGR627 IGR625 IGR626 IGR621 IGR622 IGR624 IGR623 CT753 icc, - CT754 CT755 CT759 mraY, - CT757 ftsW, - CT760 murD, - CT758 murF, - CT756 murC,murF, - CT762 CT753 icc, - CT754 CT755 CT759 mraY, - CT757 ftsW, - CT760 murD, - CT758 murF, - CT756 murC,murF, - CT762 icc, - CT754 CT755 CT753 CT759 mraY, - CT757 ftsW, - CT760 murD, - CT758 murF, - CT756 murG, - CT761 murG, - CT761 murC,murF, - CT762
* Calculated from Protein Sequence

Gene ID: CT757

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
mraY  

Definition:
phospho-N-acetylmuramoyl pentapeptide transferase

Gene Start:
889804

Gene Stop:
890811

Gene Length:
1008

Molecular Weight*:
37078

pI*:
8.66

Net Charge*:
11.30

EC:
2.7.8.13  

Functional Class:
cell envelope; peptidoglycan  

Pathway: pathway table
Metabolism of Complex Carbohydrates; Peptideglycan biosynthesis

Comment:
In E.coli, this enzyme is involved in the first step of lipid cycle reactions
in peptidoglycan biosynthesis. See CT756, CT758, CT759, CT760, CT761, and CT762.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to phospho-N-acetylmuramoyl pentapeptide transferase sequences, e.g. residues
15-335 are 38% similar to MRAY_ECOLI. CT757 is similar to TP0345 in
T.pallidum. No similarity to M.genitalium.

CT757 is orthologously related to CPn0900: residues 15-333 of CT757 are 49%
similar to residues 25-346 of CPn0900, a predicted phospho-N-acetylmuramoyl
pentapeptide transferase from C. pneumoniae.

COGS Summary:  COGS Search
BeTs to 15 clades of COG0472
COG name: UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N- acetylglucosamine-1-phosphate transferase
Functional Class:  M
The phylogenetic pattern of COG0472 is -mTkyQVCEBRHUJ--olinX
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 186-204 and 183-201 are matched to block PR00671A, concerned with inhibin beta B chain sequences, e.g. IHBB_BOVIN.
Residues 162-179 and 226-242 are matched to blocks PR00211A,C, concerned with glutelin signature sequences, e.g. GLU2_MAIZE.

ProDom Summary:  Protein Domain Search
Residues 133-276 reveal the closest domain to be a stretch of GPT_SULAC (29%).
Residues 159-191, 261-286, 287-330 correspond to defined MRAY domains as seen
in MRAY_ECOLI, MRAY_BACSU, MRAY_HAEIN.

Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis.

Pfam Summary:  Pfam Search
Residues 83 to 266 (E-value = 2.8e-40) place CT757 in the Glycos_transf_4 family which is described as Glycosyl transferase (PF00953)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
8  
27
transmembrane  
59  
93
transmembrane  
123  
143
transmembrane  
148  
175
transmembrane  
190  
207
transmembrane  
211  
228
transmembrane  
247  
281
transmembrane  
317  
335

PDB Hit:
none

Gene Protein Sequence:
MLPLTYVVKAFSIGLFFSLFLMKPLISWLKKQGFQDHIHKDHCEKLEELH
KDKAYIPTAGGIVFVFASVLAVLLLFPIQLWSTWFCIGTILLWGALGWCD
DQIKNRRRVGHGLSAKHKFLIQNCLAAGVVLPIMFAYKESFLSFHLPFLG
IVSLPHHWWSYLLSFAIATLAIVGTSNSVNLTDGLDGLAAGAMVIACLGM
LVVACTNGAPWAFICCVLLATLAGSCLGFLRYNKSPARVFMGDTGSLFLG
AMLGMCAVLLRAEFLLLFMGGIFVLESLSVIVQVGSYKLRKKRVFLCAPL
HHHYEYKGLSEKAVVRNFLIVELICVVVGIIAVFVD

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTGCCCCTAACGTATGTTGTGAAAGCCTTTTCTATTGGCTTGTTTTT
TAGCCTTTTTTTGATGAAACCTTTGATTTCTTGGTTAAAAAAACAAGGTT
TTCAAGATCATATTCACAAAGATCACTGCGAAAAATTAGAAGAGTTACAT
AAAGACAAAGCATATATCCCTACAGCTGGAGGGATAGTTTTTGTTTTTGC
ATCTGTGTTGGCGGTTCTTTTATTGTTCCCCATACAGCTTTGGTCTACAT
GGTTTTGTATTGGAACTATTCTATTATGGGGAGCATTAGGATGGTGCGAT
GATCAGATTAAAAATCGGCGTAGAGTAGGGCATGGGTTGTCTGCTAAACA
TAAGTTTCTTATACAGAATTGTTTGGCTGCAGGGGTGGTTCTTCCTATTA
TGTTCGCATATAAAGAAAGTTTTCTTAGTTTTCATCTTCCTTTTCTAGGA
ATCGTTTCTTTGCCACATCATTGGTGGAGCTATCTACTCAGTTTTGCTAT
TGCAACATTGGCTATTGTTGGAACGAGCAATTCAGTCAATCTCACTGATG
GATTGGATGGACTTGCGGCAGGAGCTATGGTGATAGCCTGCTTAGGGATG
CTTGTCGTTGCTTGTACTAATGGAGCTCCTTGGGCCTTCATTTGTTGTGT
TCTTCTAGCTACCTTAGCTGGAAGTTGTCTTGGATTTTTACGTTACAACA
AGTCTCCTGCCCGTGTCTTTATGGGAGATACAGGATCTTTGTTTTTAGGA
GCCATGCTCGGTATGTGTGCTGTATTATTACGAGCAGAGTTTCTTCTCTT
GTTTATGGGAGGGATTTTTGTTCTGGAATCACTATCTGTGATTGTACAAG
TCGGAAGTTATAAATTAAGAAAGAAACGAGTCTTTCTTTGTGCCCCTTTA
CACCATCATTATGAGTATAAGGGGTTATCAGAAAAGGCTGTAGTGAGGAA
TTTCTTAATTGTCGAGCTTATTTGTGTAGTAGTTGGGATCATTGCAGTAT
TTGTGGAT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy