Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Cys-1 IGR625 IGR626 IGR620 IGR621 IGR622 IGR624 IGR619 IGR623 CT753 amn, - CT751 icc, - CT754 CT755 efp, - CT752 CT759 mraY, - CT757 ftsW, - CT760 murD, - CT758 murF, - CT756 CT753 amn, - CT751 icc, - CT754 CT755 efp, - CT752 CT759 mraY, - CT757 ftsW, - CT760 murD, - CT758 murF, - CT756 CT753 amn, - CT751 icc, - CT754 CT755 efp, - CT752 CT759 mraY, - CT757 ftsW, - CT760 murD, - CT758 murF, - CT756 murG, - CT761 murG, - CT761
* Calculated from Protein Sequence

Gene ID: CT756

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
murF  

Definition:
N-acetylymuramoylalanyl-D-glutamate-2,6,-diaminopimelate-D-alanine-D-alanine ligase

Gene Start:
888306

Gene Stop:
889655

Gene Length:
1350

Molecular Weight*:
49281

pI*:
5.36

Net Charge*:
-9.75

EC:
6.3.2.15  

Functional Class:
cell envelope; peptidoglycan  

Pathway: pathway table
Amino Acid Metabolism; Lysine biosynthesis
Metabolism of Complex Carbohydrates; Peptideglycan biosynthesis

Comment:
This enzyme catalyzes the last step in the synthesis of
N-acetylymuramoyl-pentapeptide, adding D-alanine-D-alanine
to the chain produced by CT268, CT758, and CT269. See also
CT757, CT758, CT759, CT760, CT761, and CT762.

Blast Summary:  PSI-Blast Search
Numerous hits in gapped BLAST to N-acetylymuramoylalanyl-D-glutamate-
2,6-diaminopimelate -D-alanyl-D-alanyl ligase sequences, e.g., residues
1-444 are approximately 21% similar to MURF_ECOLI. CT756 is similar to TP0386
in T.pallidum. No similarity to M.genitalium.
CT756 is orthologously related to CPn0899: residues 1-447 are 55% similar to CPn0899.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0770
COG name: UDP-N-acetylmuramyl pentapeptide synthase
Functional Class:  M
The phylogenetic pattern of COG0770 is -mt--qvcebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
None.

ProDom Summary:  Protein Domain Search
Residues 25-212 are approximately 31% similar to an
N-acetylymuramoylalanyl-D-glutamate-2,5-diaminopimelate
alanyl-alanyl ligase domain as observed in MURF_SYNY3.

Paralogs:  Local Blast Search
CT756 is paralogously related to CT269, thought to be the same kind of ligase:
residues 75-176 are 27% similar to CT269.

Pfam Summary:  Pfam Search
Residues 37 to 303 (E-value = 2.4e-13) place CT756 in the Mur_ligase family which is described as Mur ligase family, catalytic domain (PF01225)
Residues 312 to 401 (E-value = 4.1e-10) place CT756 in the Mur_ligase_C family which is described as Mur ligase family, glutamate ligase domain (PF02875)

Structural Feature(s):
Feature Type  Start  Stop
non-globular  
1  
122
transmembrane  
277  
296

PDB Hit:
none

Gene Protein Sequence:
MRPILLEEWSSLLLGMEIPRSGKKVTGVAIDSRFVLPGDVFFALPGNRTS
GHLFLKQAAQSGAVAAVVASDYHGPSYGLQLLRVADPREALRAAGRTQGA
LFYGEVIGITGSVGKTTTKNFANQLLSSVYKVFMSPKSYNSQLTLPLSVL
MADGDEDFLLLEMGVSEPNNMKNLLEIIEPTIGVITHIDVQHAVHFLDKG
AQGIVEEKSLLLERCGLQLIPKDSSWFQFFAKKNSAADRFSFSMSNETAD
FYYRAIHSEGVLISAPDGDIELPAVFPYSPAYMNFIIAVALAWITNVPMD
RLEQVSQSLFLPAMRFEQQEHNGIRVINDAYNASPDAMLAALDAVPVPPE
GGKIIFILGHMAELGRYSDECHIAAARKAVTKAHIIFFVGEKWFPVRDIV
RDADCQIGFYSAVSEIMDAVKALVQQGDVVLLKGSRSLELETLLPCFSIS


Gene Nucleotide Sequence:  Sequence Viewer
ATGCGCCCTATTTTGTTGGAAGAATGGTCTTCTTTGTTATTAGGTATGGA
AATCCCTCGCTCGGGGAAGAAAGTGACAGGAGTTGCTATTGACAGTCGAT
TCGTATTGCCTGGGGACGTGTTTTTTGCTCTTCCTGGGAATCGAACGAGT
GGCCACCTATTTTTAAAACAAGCAGCACAATCTGGAGCAGTTGCTGCTGT
AGTCGCAAGCGATTATCATGGTCCAAGTTACGGTCTGCAGTTATTGCGTG
TGGCGGATCCTCGAGAAGCTTTACGGGCAGCGGGGCGTACCCAAGGAGCT
CTTTTCTATGGAGAAGTTATAGGAATCACTGGATCTGTAGGGAAGACAAC
TACTAAAAATTTTGCAAATCAGTTGCTTTCTTCTGTCTATAAAGTCTTTA
TGAGTCCCAAAAGCTACAATTCGCAGTTGACGCTGCCTTTAAGCGTTTTA
ATGGCCGATGGGGATGAGGATTTTTTACTTCTAGAGATGGGAGTTTCTGA
ACCTAATAACATGAAGAATCTTTTGGAGATCATTGAGCCTACAATCGGTG
TGATCACACATATCGACGTGCAGCATGCTGTGCATTTTCTGGATAAAGGG
GCTCAAGGTATCGTCGAGGAAAAAAGCTTGCTGTTGGAAAGATGTGGGTT
GCAGCTCATTCCTAAAGACTCTTCTTGGTTTCAGTTTTTTGCAAAAAAGA
ATTCTGCAGCAGATCGGTTTTCTTTTTCTATGAGCAATGAAACGGCAGAT
TTTTATTATCGAGCGATTCATTCCGAAGGAGTCCTTATTAGTGCTCCTGA
TGGGGACATTGAGTTGCCTGCCGTATTTCCGTATTCTCCAGCGTATATGA
ATTTTATTATTGCAGTAGCTTTGGCTTGGATTACGAATGTTCCCATGGAT
CGTTTAGAGCAGGTGAGTCAGTCTCTGTTTTTGCCTGCCATGCGTTTCGA
ACAGCAAGAGCACAATGGTATCCGAGTGATTAATGATGCATATAATGCTA
GTCCTGATGCAATGCTAGCTGCTTTAGATGCTGTTCCTGTTCCTCCAGAG
GGAGGTAAGATCATTTTTATCCTTGGGCATATGGCGGAGTTAGGACGATA
TTCCGATGAATGCCATATTGCTGCAGCTAGGAAAGCTGTGACAAAAGCTC
ACATCATCTTTTTTGTTGGAGAGAAATGGTTCCCTGTTAGGGATATAGTT
CGTGATGCGGATTGCCAGATTGGGTTTTATAGCGCAGTGAGCGAGATTAT
GGATGCCGTGAAAGCTCTCGTTCAACAGGGAGATGTTGTGTTGTTAAAAG
GGTCTCGTAGTTTAGAACTAGAGACTTTATTACCATGCTTTTCGATTTCA



Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy