Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap tRNA-Cys-1 rRNA-5SrRNA_2 rRNA-23SrRNA_2 IGR618 IGR620 IGR621 IGR622 IGR619 IGR623 IGR617 CT753 amn, - CT751 icc, - CT754 CT755 efp, - CT752 murF, - CT756 tktB, - CT750 CT753 amn, - CT751 icc, - CT754 CT755 efp, - CT752 murF, - CT756 tktB, - CT750 CT753 amn, - CT751 icc, - CT754 CT755 efp, - CT752 murF, - CT756 tktB, - CT750
* Calculated from Protein Sequence

Gene ID: CT751

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
amn  

Definition:
AMP nucleosidase

Gene Start:
884288

Gene Stop:
883422

Gene Length:
867

Molecular Weight*:
32035

pI*:
6.67

Net Charge*:
-1.78

EC:
3.2.2.4  

Functional Class:
purines, pyrimidines, nucleosides and nucleotides; purines  

Pathway: pathway table
Nucleotide Metabolism; Purine metabolism

Comment:
In E.coli, this enzyme regulates AMP concentrations by hydrolyzing AMP (to adenine and D-ribose-5-phosphate).

Blast Summary:  PSI-Blast Search
Several hits in gapped BLAST to AMP nucleosidase sequences, e.g. residues 18-253 are 27% similar to AMN_ECOLI.
CT751 is similar to TP1027, a predicted uridine phosphorylase in T.pallidum. No
similarity to M.genitalium.

CT751 is orthologously related to CPn0894: residues 6-289 are 69%
similar to CPn0894.

COGS Summary:  COGS Search
BeTs to 4 clades of COG0775
COG name: Nucleoside phosphorylase
Functional Class:  F
The phylogenetic pattern of COG0775 is ------vcEbRhuj--OliN-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 93-106 and 186-214 are matched to blocks BL01232C,E, which encompass phosphorylase family 1 proteins, e.g. DEOD_MYCGE, MTAP_SULSO.

ProDom Summary:  Protein Domain Search
Residues 70-253 are 28% similar to an AMP nucleosidase domain as observed in AMN_ECOLI.
Residues 18-45 support this finding. Residues 122-164 are 37% similar to a stretch of UDP_HAEIN.

Paralogs:  Local Blast Search
No evidence of paralogs in C.trachomatis.

Pfam Summary:  Pfam Search
Residues 37 to 249 (E-value = 7.8e-08) place CT751 in the PNP_UDP_1 family which is described as Phosphorylase family (PF01048)

PDB Hit:
none

Gene Protein Sequence:
MTHQHKKISEETIACDMLERYTGSTVQEFQPYLLLTNFAYYVDVFAEIYQ
VPVSRGSMFSAAHAPQIHTSIIDFKLGSPGAALTVDLCSFLPNATAAIML
GMCGGLRSHYQIGDYFVPVASIRKDGTSDAYFPPEVPALANFVVQKMITN
ILEAKNLPYHIGITHTTNIRFWEFNKEFRRKLYENKAQTVEMECATLFAA
GYRRNLPLGALLLISDLPLRKDGIKTKESSSAVLNSHTKEHILTGVEVFA
SLQEKSGPGIKKTKGLPHMEFGQADDSLSEQTEVSGGDF

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCCATCAGCATAAAAAAATCAGCGAAGAAACAATCGCCTGTGACAT
GCTAGAGCGCTATACCGGCTCTACCGTTCAAGAGTTCCAGCCCTATCTCC
TTCTTACTAATTTTGCGTATTACGTGGATGTTTTCGCTGAAATCTATCAG
GTCCCTGTTTCTCGAGGATCCATGTTTTCGGCAGCGCATGCGCCTCAAAT
TCACACCTCAATCATCGATTTTAAATTAGGCTCTCCAGGAGCAGCTCTTA
CCGTAGATCTGTGTTCTTTCCTTCCCAATGCTACAGCAGCGATCATGTTG
GGCATGTGTGGAGGCTTAAGATCCCACTACCAAATAGGAGATTATTTTGT
CCCTGTTGCTAGCATCCGAAAAGATGGAACATCAGATGCATACTTCCCCC
CAGAGGTCCCTGCATTAGCTAATTTTGTCGTACAAAAAATGATCACCAAT
ATTCTCGAAGCCAAAAACCTCCCTTACCATATAGGCATCACCCACACGAC
TAACATTCGGTTTTGGGAGTTTAATAAAGAGTTCCGTCGAAAACTATATG
AAAATAAAGCTCAAACTGTCGAGATGGAGTGTGCCACCTTATTTGCTGCA
GGATACCGAAGGAATCTTCCTTTAGGAGCACTTTTGCTGATATCGGATCT
ACCTTTGCGAAAAGATGGAATTAAAACTAAGGAAAGCAGTTCGGCAGTCC
TAAACTCTCACACCAAAGAGCATATACTAACAGGCGTTGAGGTGTTTGCC
TCTCTACAAGAGAAATCAGGCCCAGGAATCAAGAAAACAAAAGGCTTGCC
GCACATGGAGTTTGGGCAAGCCGATGATTCTCTTTCTGAACAAACTGAAG
TTTCTGGCGGGGATTTC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy