Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR615 IGR616 hemG, - CT745 hemN, - CT746 mfd, - CT748 CT744 hemG, - CT745 hemN, - CT746 mfd, - CT748 CT744 hemG, - CT745 hemN, - CT746 mfd, - CT748 hemE, - CT747 alaS, - CT749 hemE, - CT747 alaS, - CT749 CT744
* Calculated from Protein Sequence

Gene ID: CT747

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hemE  

Definition:
uroporphyrinogen decarboxylase (UPD)

Gene Start:
869740

Gene Stop:
868733

Gene Length:
1008

Molecular Weight*:
37690

pI*:
5.88

Net Charge*:
-5.21

EC:
4.1.1.37  

Functional Class:
cofactor biosynthesis; heme and porphyrin  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Porphyrin and chlorophyll metabolism

Secondary Evidence:
Nishimura,K., Nakayashiki,T. and Inokuchi,H. 1993. Cloning and sequencing of the hemE gene encoding uroporphyrinogen III decarboxylase (UPD) from Escherichia coli K-12. Gene 133(1): 109-113. Medline: 94040783.

Hansson,M. and Hederstedt,L. 1992. Cloning and characterization of the Bacillus subtilis hemEHY gene cluster, which encodes protoheme IX biosynthetic enzymes. J. Bacteriol. 174(24): 8081-8093. Medline: 93094140.

Comment:
This enzyme in B. subtilis converts uroporphyrinogen III to coproporphyrinogen III. See CT745 and CT746.



Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to uroporphyrinogen decarboxylase sequences, e.g. residues 19-321 are 30% similar to DCUP_BACSU.

CT747 is orthologous to CPn0890: residues 3-328 are 59% similar to
CPn0890. No similarities to T. pallidum or M. genitalium sequences.

COGS Summary:  COGS Search
BeTs to 9 clades of COG0407
COG name: Uroporphyrinogen-III decarboxylase
Functional Class:  H
The phylogenetic pattern of COG0407 is ----yq-cebr-uj----inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 19-31, 31-80, 49-98, 127-156, 163-213, 248-257 are matched to blocks BL00906A-E, concerned with
uroporphyrinogen decarboxylase sequences, e.g. DCUP_CAUCR, DCUP_MYCLE, DCUP_HUMAN.

ProDom Summary:  Protein Domain Search
Residues 19-321 are 30% similar to a uroporphryinogen decarboxylase domain as observed in DCUP_BACSU.

Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis.

Pfam Summary:  Pfam Search
Residues 1 to 333 (E-value = 1.4e-46) place CT747 in the URO-D family which is described as Uroporphyrinogen decarboxylase (URO-D) (PF01208)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
60  
81
transmembrane  
127  
143

PDB Hit:
None.

Gene Protein Sequence:
MPMTGFYETISPRDQQRPPIWFLRQVGRYIPQYQELKRNRSLKDFFLDTE
SIVEATLLGPSLLGVDAAIVFADILSILEGFSVDYRFAPGPEVSYSPHEP
LIFTKDPQETFSFLLEAIQQLTKRLTVPLIAFAASPFTLASYLIEGGASR
DYPKTIAFLYQYPDRFKALLDEITLGTATYLQMQVQAGAAAIQLFESSSL
RLPPHLFAKYVVAPNTKLIRQIKQTGNPPISLFCRCFYQEFLSLYAIGAD
TLHPDYHVELPEVYRQIHSPGSIQGNFDPALLLLPQDALIAHLEAYLAPL
KQQSHYIFNLGHGILPQTPIENVQAVVSCLTSISTS

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCTATGACCGGGTTTTATGAAACCATCTCCCCTCGAGATCAACAACG
TCCGCCAATATGGTTCCTCCGCCAAGTGGGGCGATATATACCTCAATATC
AAGAGCTGAAAAGAAACCGTTCTTTGAAAGATTTTTTTTTGGATACTGAG
TCTATTGTAGAAGCGACGCTATTAGGGCCTTCTTTATTAGGAGTAGATGC
CGCTATTGTCTTTGCTGATATTCTCTCTATTCTAGAAGGGTTTTCTGTCG
ATTATCGATTTGCTCCTGGGCCAGAGGTTAGCTATTCCCCTCATGAACCT
CTTATTTTCACAAAAGATCCTCAAGAAACATTCTCATTTCTACTGGAAGC
TATCCAGCAACTAACGAAACGTCTCACGGTCCCTTTGATTGCCTTTGCCG
CTTCTCCTTTTACTCTCGCCAGTTATCTAATAGAGGGGGGAGCATCTAGA
GACTACCCTAAAACAATTGCATTCCTCTATCAATATCCCGACAGATTTAA
AGCTTTATTGGATGAAATCACTCTAGGAACCGCTACTTATCTCCAGATGC
AGGTGCAAGCTGGAGCTGCAGCGATTCAATTGTTTGAATCTTCGAGTTTA
CGACTGCCTCCTCACCTCTTTGCAAAATACGTAGTTGCTCCCAATACCAA
GCTAATCCGTCAAATCAAGCAGACAGGGAATCCTCCTATTAGTCTGTTCT
GCCGATGCTTTTACCAAGAATTTTTGTCTCTATATGCGATTGGAGCAGAT
ACCTTACATCCCGATTATCACGTAGAGCTCCCAGAGGTTTACCGTCAGAT
ACATAGTCCCGGATCTATCCAAGGAAATTTCGATCCTGCTCTTTTACTAC
TTCCCCAAGACGCACTGATTGCTCACCTTGAAGCTTATCTTGCTCCCTTA
AAACAGCAATCGCATTATATTTTCAATTTAGGGCATGGTATCTTACCTCA
AACGCCAATAGAAAATGTACAGGCTGTTGTATCATGTTTAACATCAATTT
CAACTTCC


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy