Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap IGR615 IGR616 IGR613 IGR614 hctA, - CT743 hemG, - CT745 trmA,gycA, - CT742 hemN, - CT746 mfd, - CT748 CT744 hctA, - CT743 hemG, - CT745 trmA,gycA, - CT742 hemN, - CT746 mfd, - CT748 CT744 Type: tandem, Name:  - 6 hctA, - CT743 hemG, - CT745 trmA,gycA, - CT742 hemN, - CT746 mfd, - CT748 hemE, - CT747 hemE, - CT747 CT744
* Calculated from Protein Sequence

Gene ID: CT745

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
hemG  

Definition:
protoporphryninogen oxidase (PPO)

Gene Start:
867387

Gene Stop:
866116

Gene Length:
1272

Molecular Weight*:
47176

pI*:
10.57

Net Charge*:
20.24

EC:
1.3.3.4  

Functional Class:
cofactor biosynthesis; heme and porphyrin  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Porphyrin and chlorophyll metabolism

Secondary Evidence:
Nishimura,K., Taketani,S. and Inokuchi,H. 1995. Cloning of a human cDNA for protoporphyrinogen oxidase by complementation in vivo of a hemG mutant of Escherichia coli. J. Biol. Chem. 270(14): 8076-8080. Medline: 95229621.

Taketani,S., Yoshinaga,T., Furukawa,T., Kohno,H., Tokunaga,R., Nishimura,K. and Inokuchi,H. 1995. Induction of terminal enzymes for heme biosynthesis during differentiation of mouse erythroleukemia cells. Eur. J. Biochem. 230(2): 760-765. Medline: 95331315

Hansson,M. and Hederstedt,L. 1992. Cloning and characterization of the Bacillus subtilis hemEHY gene cluster, which encodes protoheme IX biosynthetic enzymes. J. Bacteriol. 174(24): 8081-8093. Medline: 93094140.




Comment:
In B. subtilis this enzyme catalyzes the penultimate step in porphyrin synthesis. Believed to be a cytoplasmically-located homodimer. See CT746 and CT747.

Blast Summary:  PSI-Blast Search
Hits in gapped BLAST to PPO sequences, e.g. residues 2-424 are 24% similar to HEMG_BACSU. Several hits to eukaryotic enzymes.

CT745 is orthologous to CPn0888: residues 1-422 are 51% similar to CPn0888. No similarities to T. pallidum or M. genitalium.

COGS Summary:  COGS Search
BeTs to 5 clades of COG1232
COG name: Protoporphyrinogen oxidase
Functional Class:  H
The phylogenetic pattern of COG1232 is a--k-q---br-------in-
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 3-22 match block PR00757A, concerned with flavin-amine sequences, e.g. AOFA_BOVIN.
Residues 3-25 also match block PR00420A, concerned with aromatic-ring hydroxylases, e.g. PHEA_PSEPU.
Residues 3-25, 4-18, 28-41 match adrenodoxin reductase sequences, e.g. GLSN_MEDSA.

ProDom Summary:  Protein Domain Search
Residues 5-304 are 25% similar to a PPO domain of PPOX_MOUSE. Residues 11-249 also match a PPO domain as seen in PPOX_ARATH.

Paralogs:  Local Blast Search
No evidence of paralogs in C. trachomatis.

Pfam Summary:  Pfam Search
Residues 11 to 423 (E-value = 3.2e-05) place CT745 in the Amino_oxidase family which is described as Flavin containing amine oxidoreductase (PF01593)

PDB Hit:
None.

Gene Protein Sequence:
MKHALIVGSGIAGLSAAWWLHKRFPHVQLSILEKESRSGGLIVTEKQQGF
SLNMGPKGFVLAHDGQHTLHLIQSLGLADELLYSSPEAKNRFIHYNNKTR
KVSPWTIFKQNLPLSFAKDFFARPYKQDSSVEAFFKRHSSSKLRRNLLNP
ISIAIRAGHSHILSAQMAYPELTRREAQTGSLLRSYLKDFPKEKRTGPYL
ATLRSGMGMLTQALHDKLPATWYFSAPVSKIRQLANGKISLSSPQGEITG
DMLIYAGSVHDLPSCLEGIPETKLIKQTTSSWDLSCVSLGWHASFPIPHG
YGMLFADTPPLLGIVFNTEVFPQPERPNTIVSLLLEGRWHQEEAYAFSLA
AISEYLQIYTPPQAFSLFSPREGLPQHHVGFIQSRQRLLSKLPHNIKIVG
QNFAGPGLNRATASAYKAIASLLS

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACATGCTCTCATTGTTGGCTCAGGTATTGCCGGCCTTTCTGCCGC
GTGGTGGCTACACAAACGATTCCCTCATGTGCAGCTGTCTATTCTAGAAA
AAGAGTCTCGATCTGGAGGGCTAATTGTCACAGAGAAACAACAAGGGTTT
TCCCTCAATATGGGCCCTAAAGGTTTTGTTTTAGCTCATGATGGGCAACA
CACCCTTCACCTCATTCAGTCTTTAGGCCTAGCAGACGAGCTATTATATA
GCTCTCCAGAGGCTAAAAACCGCTTTATCCACTATAATAATAAAACCCGA
AAAGTCTCGCCTTGGACTATTTTCAAACAAAATCTCCCTCTCTCTTTTGC
TAAGGATTTCTTTGCGCGTCCTTACAAACAAGACAGCTCCGTGGAAGCCT
TCTTTAAAAGACACAGTTCTTCCAAGCTTAGAAGAAATCTTTTAAATCCC
ATTAGCATTGCTATTCGTGCAGGACATAGTCATATATTGTCTGCACAGAT
GGCTTACCCAGAATTAACACGAAGAGAAGCTCAAACAGGATCGTTGTTAC
GTAGTTATCTCAAAGATTTTCCTAAAGAGAAACGCACAGGCCCTTATTTA
GCTACCTTGCGGTCTGGGATGGGAATGCTAACCCAGGCTTTGCATGATAA
ATTGCCTGCTACCTGGTATTTTTCTGCACCCGTCAGCAAAATCCGTCAGT
TGGCGAATGGGAAAATTTCTCTTTCATCTCCTCAAGGAGAAATAACGGGA
GATATGCTCATTTATGCTGGGTCCGTGCACGATCTCCCTTCCTGTCTAGA
AGGGATCCCTGAAACCAAGCTTATCAAGCAAACGACTTCATCTTGGGATC
TCTCTTGTGTATCTTTAGGATGGCATGCATCCTTCCCTATCCCTCATGGA
TATGGCATGCTTTTCGCTGATACGCCTCCCTTATTAGGGATCGTGTTTAA
TACGGAAGTGTTCCCTCAACCCGAGCGGCCTAATACAATAGTCTCTCTTC
TTTTAGAAGGTCGATGGCACCAAGAAGAAGCGTATGCTTTCTCACTAGCA
GCTATTTCTGAGTACCTGCAAATTTACACTCCTCCCCAAGCTTTCTCACT
ATTCTCTCCTCGAGAGGGACTTCCCCAACACCATGTTGGATTTATCCAAT
CCCGCCAACGCCTTCTATCTAAACTTCCTCACAATATAAAAATTGTAGGG
CAGAATTTTGCAGGTCCAGGTCTCAACCGCGCTACAGCGTCTGCTTATAA
AGCTATAGCTTCTTTACTATCA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy