Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Chlamydia trachomatis Search Results

Record: 1 of 1  
MiniMap rRNA-5SrRNA_1 rRNA-23SrRNA_1 IGR615 IGR613 IGR612 IGR611 IGR614 IGR610 CT741 hctA, - CT743 hemG, - CT745 trmA,gycA, - CT742 nqr6,dmpP, - CT740 CT744 CT741 hctA, - CT743 hemG, - CT745 trmA,gycA, - CT742 nqr6,dmpP, - CT740 CT744 Type: tandem, Name:  - 6 CT741 hctA, - CT743 hemG, - CT745 trmA,gycA, - CT742 nqr6,dmpP, - CT740 CT744
* Calculated from Protein Sequence

Gene ID: CT742

DNA Molecule Name:
1  

Genbank ID:


Gene Name:
trmA  gycA  

Definition:
probable RNA methyltransferase

Gene Start:
862794

Gene Stop:
861505

Gene Length:
1290

Molecular Weight*:
48566

pI*:
8.08

Net Charge*:
6.32

EC:
2.1.1.-  

Functional Class:
translation; ribosomal proteins  

Pathway: pathway table
Metabolism of Cofactors, Vitamins, and Other Substances; Ubiquinone biosynthesis

Comment:
CT742 has 97 additional residues at the N-terminus compared to HOM1_CHLTR. Removing those could make CT742 short compared to other bacterial RNA methylases. A BLAST-clustal alignment shows CT742 to be shorter than many bacterial RNA methyltransferases.

Blast Summary:  PSI-Blast Search
CT742 is orthologously related to CPn0885: residues 36-428 of CT742 are 63% similar to residues 1-397 of CPn0885, a probable RNA methyltransferase from C. pneumoniae.

CT742 is identical to the previously published pCTMom1 sequence M94254 from trachomatis, also known as HOM1_CHLTR, however residue 98 of CT742 corresponds to residue 1 of HOM1_CHLTR, suggesting that the wrong start may have been selected in one or the other. Other similarities in gapped BLAST to RNA methylase sequences. No simialrities to T. pallidum or M. genitalium.

COGS Summary:  COGS Search
BeTs to 9 clades of COG2265
COG name: SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase (trmA)
Functional Class:  J
The phylogenetic pattern of COG2265 is -----qv-ebrhuj--o-inx
Number of proteins in this genome belonging to this COG is 1


Blocks Summary:  Blocks Search
Residues 288-300, 356-366, 381-398, 412-421 are matched to blocks BL01230A,B,C,D, concerned with RNA methylase sequences, e.g. HOM1_CHLTR.

ProDom Summary:  Protein Domain Search
Residues 98-257 are identical to an RNA methylase domain of HOM1_CHLTR. Residues 289-348, 382-427, 349-381 are also recognized domains of HOM1_CHLTR. Residues 270-401 are 24% similar to a domain of YHHF_HAEIN. Residues 286-361 and 273-332 also correspond to domains of hypothetical proteins.

Paralogs:  Local Blast Search
No strong evidence of paralogs in C.trachomatis. Residues 230-320 are 26% similar to a stretch of CT435, thought to be a sulfite reductase.

Pfam Summary:  Pfam Search
Residues 57 to 429 (E-value = 2.1e-08) place CT742 in the tRNA_U5-meth_tr family which is described as tRNA (Uracil-5-)-methyltransferase (PF05958)

Structural Feature(s):
Feature Type  Start  Stop
transmembrane  
292  
312

PDB Hit:
None.

Gene Protein Sequence:
MLSFPFSQRQVLANKSTTSHLLWRKNLSLSLGFKLLSCYRNCKHFGVCGG
CSSPQMEYASSLKTKELALHNLFAPLIPSQNILPVIPCSPLLRGRNKMEF
SFYQTVDGEKTLGFISPSKPKKGIPITECLMIDERAMDILNITRSWWTAH
PDLSAYYPPLNKGSLCTITVRVGNISNDFMIILTTSGREEFAVPLNIIQE
WQQSLLDSGLPITSIFWEEKLSARNSPTTFRTTHLYGAPFLKQQLSIDGR
SSLFHIRPRSFFQPQSLQAEKIIQTIKEFIDPCGEETLLDLYCGAGIIGI
LLAPYVKKIIGVELVPDAVASAQENIQLNSVDMEVFLEDAKQFCKRNENL
PSPDIVVIDPPRCGMQNRALKYLLRMAPKKIVYVSCNPLTQIQECSVLVE
QGYQLRRMQPIDQFPHTNHLENIVLLERLS

Gene Nucleotide Sequence:  Sequence Viewer
TTGTTATCCTTTCCGTTCTCGCAAAGGCAAGTCCTTGCAAATAAAAGTAC
AACCTCACACCTCCTTTGGAGGAAAAACCTTTCACTTTCTTTAGGATTCA
AGTTGCTCTCCTGCTATCGTAACTGTAAACATTTTGGCGTCTGTGGAGGC
TGTTCATCTCCTCAAATGGAATATGCATCCTCTTTAAAAACAAAAGAGCT
TGCGCTCCATAATTTATTTGCACCTCTTATCCCATCCCAAAATATTCTCC
CTGTAATTCCTTGTTCTCCTCTTCTTCGTGGAAGAAATAAAATGGAATTT
TCTTTTTACCAAACGGTTGATGGAGAAAAAACTTTAGGTTTTATTTCTCC
ATCAAAACCTAAAAAAGGAATCCCAATTACCGAATGTTTAATGATTGATG
AGCGTGCCATGGATATCCTTAATATCACTCGCTCATGGTGGACTGCCCAT
CCTGACCTGTCTGCGTACTATCCACCATTAAATAAAGGCTCCTTGTGCAC
TATTACAGTCCGGGTAGGCAATATCTCTAATGATTTTATGATTATTCTGA
CTACATCAGGAAGAGAAGAATTCGCTGTACCTCTGAATATAATCCAAGAA
TGGCAACAATCTTTATTAGATTCTGGACTACCGATTACTTCGATTTTCTG
GGAAGAAAAACTCTCCGCACGGAACTCTCCCACAACCTTCCGGACAACTC
ATCTATACGGAGCTCCTTTCCTCAAACAACAATTATCGATAGATGGCCGT
TCTAGTCTCTTCCATATCCGTCCAAGAAGCTTTTTCCAGCCACAAAGCCT
CCAAGCAGAAAAAATCATTCAAACTATCAAAGAATTCATTGATCCTTGCG
GAGAAGAGACTCTCTTGGATCTATATTGCGGAGCTGGGATTATCGGCATT
TTACTGGCTCCTTACGTAAAAAAAATTATTGGAGTCGAACTAGTCCCGGA
TGCTGTTGCTTCAGCACAAGAAAATATTCAGCTTAATTCCGTGGATATGG
AAGTGTTTTTGGAAGATGCAAAACAATTTTGCAAACGGAATGAAAACCTT
CCTTCCCCAGATATTGTAGTCATCGATCCTCCTCGTTGCGGCATGCAAAA
TAGAGCCTTAAAATACCTTTTACGCATGGCTCCTAAAAAAATTGTGTATG
TCTCCTGCAATCCTCTTACACAAATCCAAGAATGCTCTGTTCTTGTAGAG
CAAGGATATCAGCTACGGCGCATGCAGCCTATTGATCAGTTTCCGCATAC
TAATCATTTGGAAAATATTGTTCTCTTAGAAAGGCTTTCT


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy